(data stored in ACNUC7421 zone)

EMBL: CR954246.PE478

CR954246.PE478       Location/Qualifiers
FT   CDS_pept        517366..517692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0502"
FT                   /product="conserved protein of unknown function ; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85592"
FT                   /db_xref="GOA:Q3IG89"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG89"
FT                   /protein_id="CAI85592.1"
FT                   /translation="MKALAVCIIVYLLFFTDVVSAVHFDTWQLPLWIADTSWTGLELIG
FT                   ALAAIIIFVAVAVLITIGLVGAAAVALVGTVLAFLFGSLMIAWPLLFIAVLCWLVADNK
FT                   KVAS"
     atgaaagcgt tagccgtatg tataattgtt tatttactat tttttactga tgttgtctct        60
     gcggtgcact ttgatacttg gcaattaccg ctttggattg cagatacaag ttggactggg       120
     cttgagctaa taggagcttt agcggctatt attatttttg tagctgttgc agtactaata       180
     acgataggat tagttggcgc agcagcagtt gcattagtcg gaactgtatt ggcattttta       240
     tttggatcgc tgatgattgc ttggccgtta ctatttattg cggtactttg ctggttagta       300
     gctgataaca aaaaagtagc atcttaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page