(data stored in ACNUC7421 zone)

EMBL: CR954246.PE479

CR954246.PE479       Location/Qualifiers
FT   CDS_pept        517771..518280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0503"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85593"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG88"
FT                   /protein_id="CAI85593.1"
FT                   /translation="MIKQCISIVLVSVLSLFSSSSMAHSGHEHDADVAIIKVSNAQVRE
FT                   FLPATTSSVGYLSIINHSDTVATLTKATIDGLGRVEIHEHSHVDGMMKMQKVESLTINA
FT                   HQQIDFKPGGYHLMIFEPQEPLKVGQQRKLTLYFSDGNRVFTNAQVVSLASQAEQSQAS
FT                   KQHTHH"
     gtgattaaac agtgtatttc aattgttttg gtgtcggttt taagtctttt ttcatcatca        60
     tcgatggcac attcagggca tgaacacgat gcggatgttg ctattattaa ggttagtaat       120
     gcacaagtaa gggagttttt acctgccaca acttcaagtg taggttattt aagtattata       180
     aatcatagtg atactgtggc tacgttgact aaagcaacta ttgatggctt aggtcgcgtt       240
     gaaattcatg agcactcgca cgtagatggc atgatgaaaa tgcaaaaagt tgaatcgtta       300
     acaattaacg cccatcaaca aatcgatttt aagcctggtg gctatcattt aatgattttt       360
     gaaccacaag aaccgttaaa agtaggccaa caacgtaaac tcacactata ttttagtgat       420
     ggcaaccgtg tatttaccaa tgctcaggtg gtatcgcttg catcacaagc agaacaatca       480
     caagcatcaa aacaacatac tcatcattag                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page