(data stored in ACNUC7421 zone)

EMBL: CR954246.PE48

CR954246.PE48        Location/Qualifiers
FT   CDS_pept        complement(52869..55586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0052"
FT                   /product="hypothetical tryptophan-rich sensor protein"
FT                   /function="1.3 : Sensors (signal transduction)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85162"
FT                   /db_xref="GOA:Q3IF06"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF06"
FT                   /protein_id="CAI85162.1"
FT                   /translation="MKNFNSKYYSSVFYIIFSLAYFFVGVILTKLTFDSQIIPVWLPAG
FT                   IALVGCFVWWWRFIPALFLAALAFNLNFFANTTHEMVLVGNSLNEAMYIAFGVVLQAMV
FT                   GAAILKFWLGHPLRLKKRQNIIYFIVVVGVLVSLISANFGVFALSQFNAMYSADNHWKN
FT                   TTYWWLGDILGVLIATPFLLSLLPEKSDNYNISVLPTLSVCCILFVSVAATTQLYDSES
FT                   RINAIKIAEREVQVIENSLYRYTNRSIIAVQSLASQVQSSPTLSQQDFNQYANTLLAKH
FT                   SFIKALSWNVKIPSHQRQAFSKEISSIYNLNYDVIGEPLEPNDPLVIVKYIAPFNSNQK
FT                   AIGFNVYSNPDRKASLLNPAIKYQPVGTKIIQLVQTEHSDAAYLLFAPVYSQSNEKETI
FT                   KGYATGVFLVPQIIKQAITEQQSKMFSIAIYEDINKPAFYSNSNNLNVAQGSKLISFNV
FT                   DFGGQQWIVKLALKDAFLAQHNNQLTLLLLILQVVVCSLILLILLLFNQQQIALTRQVA
FT                   ERTYSLAQAKKQSDLANRAKSQFLANMSHEIRTPLNAVIGFSSLARKEDDANTLIDYLD
FT                   KINSSSKSLLNLINDILDISKIESKRLVLERIPFDLTALIQRINTMFEQSAASKAIVWK
FT                   INSNIPKDTWFVGDPMRLEQIMLNLCSNAIKFTNAGSVTLNVDTQLIAPNKAQLTIAVI
FT                   DTGIGIKATQHEKLFSAFTQADNSTSRQFGGTGLGLAIAKELSVLMNANIALHSELDKG
FT                   STFTFTLEIETVKAQDPLIKPTDNTNIAALKILVAEDNPVNQMVIKAMLGSLKIVPQVV
FT                   ENGELAVNIIKKQHFDLVFMDCQMPVMDGYRATALIRQFKTAEELPIVALTADVMPEDK
FT                   AHAQAVGFNQHLAKPLELIKLTECLAQYAVVYEQ"
     gtgaaaaatt ttaactccaa gtattactct agtgtttttt acattatttt ttctttagcc        60
     tatttttttg taggagtaat acttaccaag ctaacctttg actcgcaaat tattccggtt       120
     tggttacctg ctggtatagc cttagttggc tgctttgtgt ggtggtggcg atttattcct       180
     gcgctatttt tagcggctct cgcatttaat ttaaattttt ttgctaatac aactcatgaa       240
     atggtattgg taggaaattc attaaacgag gctatgtata ttgcctttgg ggtggtattg       300
     caggccatgg ttggggccgc aatattaaag ttttggttag gccaccctct gcgccttaaa       360
     aagcgccaaa acattattta ttttattgta gttgtaggtg ttttagtcag tttaatttcg       420
     gctaattttg gcgtgtttgc actaagccaa tttaatgcaa tgtacagtgc agataatcac       480
     tggaaaaaca caacttactg gtggttaggt gatattttag gggtgttaat tgccactcca       540
     tttttacttt cgttattacc agagaagtct gataactata atatttcggt gctaccgaca       600
     ctttcggtat gttgcatttt atttgtatca gtagcggcca ccacacaatt atacgatagt       660
     gaaagccgta ttaatgcgat aaaaattgct gagcgcgaag tgcaagtgat agaaaacagc       720
     ctgtaccgct atactaatcg cagcattatt gcagtgcaaa gtttagctag ccaagttcag       780
     tcatcgccaa cattaagcca gcaagacttt aatcaatatg ccaacaccct acttgctaag       840
     cactcattta taaaagcttt atcatggaat gtaaaaatcc catctcatca acgccaagca       900
     ttctctaaag aaatttcaag catttataac ttaaattatg atgttattgg tgaaccttta       960
     gagccaaacg atccactcgt tattgtaaaa tatatagcac cgtttaatag caaccaaaaa      1020
     gcaattgggt ttaatgtata ttcaaaccca gatcgcaaag catccttact caaccccgca      1080
     ataaagtatc agccagtggg aactaaaata attcaactcg tacaaactga gcactctgat      1140
     gctgcttact tattatttgc gcctgtatat tctcaatcca atgaaaaaga aactattaaa      1200
     ggctatgcca caggcgtatt tttagtccct caaattatta agcaggccat tactgagcag      1260
     cagtctaaaa tgttttcgat tgctatttat gaagatataa acaaacccgc attttacagt      1320
     aactcaaaca atcttaatgt tgcacaaggc agtaagctaa tatcgtttaa tgtcgatttt      1380
     ggcgggcaac aatggatcgt aaaactggca cttaaagatg cctttttagc tcaacataat      1440
     aatcaactca ccttactgct gctgatactt caagtagttg tatgctcatt aattttattg      1500
     attttactac tgtttaatca gcagcaaatt gcacttactc gccaagtagc agagcgtact      1560
     tattcgttag cacaagcaaa aaagcaatct gatttggcta accgggctaa gagtcaattt      1620
     ttagctaata tgagccatga aatacgcacg ccactaaatg ctgttattgg cttttcttcg      1680
     cttgcccgta aagaagacga cgccaatacc ctaattgatt atttagataa aataaattcg      1740
     tcatctaaaa gcttattaaa tttgataaac gatattctcg atatatctaa aattgaatca      1800
     aaacggctag tgcttgaacg tattccattt gatttaaccg cacttattca gcgcattaat      1860
     actatgtttg aacaaagtgc tgcaagcaaa gcaattgtgt ggaaaataaa tagcaacatc      1920
     cctaaagaca cttggtttgt tggcgatcca atgcgattag agcaaataat gcttaattta      1980
     tgcagtaacg ctattaaatt tactaacgct ggcagtgtta ctttaaatgt agatacgcaa      2040
     cttattgcgc ccaataaagc acagctaaca attgccgtta ttgataccgg aataggtata      2100
     aaagcaactc aacatgaaaa gttatttagt gcatttactc aagccgataa ctctacttct      2160
     cggcagtttg gtggcaccgg ccttgggtta gccatagcca aagagcttag tgtattaatg      2220
     aatgcaaata tagcgctaca tagcgagctt gataaaggct ctacttttac atttacatta      2280
     gaaatagaga cggttaaagc gcaagacccc cttataaaac ctacagataa tactaatata      2340
     gccgctttaa aaattttagt ggccgaagat aacccggtta atcaaatggt tataaaagcc      2400
     atgcttggct cactaaaaat tgtgccacag gttgttgaaa atggtgagct tgcagttaat      2460
     attataaaaa aacagcattt tgacctcgtg tttatggatt gccaaatgcc agtaatggat      2520
     ggctatagag caacggccct aatcaggcaa tttaaaacgg ctgaggaact gccaattgtt      2580
     gccttaactg ccgacgttat gcccgaagac aaagcacacg ctcaggcggt tggttttaat      2640
     caacaccttg caaaaccgct tgaactaatt aagctaaccg agtgtcttgc tcaatatgca      2700
     gtggtttatg aacaataa                                                    2718
//

If you have problems or comments...

PBIL Back to PBIL home page