(data stored in ACNUC7421 zone)

EMBL: CR954246.PE480

CR954246.PE480       Location/Qualifiers
FT   CDS_pept        518289..519275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0504"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85594"
FT                   /db_xref="InterPro:IPR016936"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG87"
FT                   /protein_id="CAI85594.1"
FT                   /translation="MSQHKGKIVAALAILLIIFYAIAVYWSTEPARFNVVEKAKQQAQQ
FT                   RNEQFVIGYTTTSTLITVASTLLEKPGGYLSNDVLPPSIIMDDMPAWEYGALEMVRDLA
FT                   LSMRKDFSRSQSQSTEHEALKKAQPQFNISSEAWAWPSAEGEYQKGIDYLLVYRTQIAN
FT                   DHERDSQFYARADNLRSWLKEAEKRLGSLSQRLSASVGQDKVNTDLAGNTSNTQATFSP
FT                   LQQQAKTPWLDIDDVFYESRGATWALLHFLQAVEYDFADVLEKKNARVSVQQIIRELEA
FT                   TQETVWSPMILNGNGFGYVANHSLVMANYISRANAALIELSELLTQG"
     atgtcacaac ataaagggaa aatagttgct gcattagcta tattactaat tattttttac        60
     gcaatagctg tttattggag tacggagcct gctcgtttta atgtggtaga aaaagcaaag       120
     cagcaagccc agcaacgtaa tgagcaattt gttattggtt atacaacaac atcaacatta       180
     ataacggtag caagtacgtt actcgaaaag ccaggcggtt atttatcaaa tgatgttttg       240
     ccgccaagta taataatgga cgatatgcct gcgtgggaat atggcgcact cgaaatggtg       300
     cgtgatttag ccctttctat gcgtaaagat tttagccgtt cgcaatcgca atcaactgaa       360
     cacgaagctc taaaaaaagc acagccgcag tttaatatta gctctgaagc gtgggcgtgg       420
     ccaagcgctg aaggtgagta ccaaaaaggc attgattact tattggtata tcgtactcaa       480
     atagcgaatg accatgagcg tgacagtcaa ttctatgctc gcgccgataa cttgcgcagt       540
     tggctaaaag aagctgaaaa gcgtttaggt agcttgagtc agcgtttaag cgctagtgta       600
     ggccaagata aagtaaacac tgatttagcg ggtaatacat caaatacaca agccactttt       660
     tctccattac aacagcaagc aaaaacgcca tggttagaca ttgatgatgt attttatgag       720
     tcgcgcggtg ctacttgggc tttattgcat ttcttacaag cggtagaata tgactttgcc       780
     gatgtacttg agaaaaagaa tgcacgcgta agtgtgcagc aaattatacg agagcttgag       840
     gcaactcaag aaacagtatg gagcccaatg atattaaatg ggaatggttt tggttatgta       900
     gcaaaccatt cactggttat ggcaaattat atttctagag ccaatgcggc tcttattgaa       960
     cttagcgaat tattgaccca aggatag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page