(data stored in ACNUC7421 zone)

EMBL: CR954246.PE481

CR954246.PE481       Location/Qualifiers
FT   CDS_pept        519279..520049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0505"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85595"
FT                   /db_xref="InterPro:IPR026387"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG86"
FT                   /protein_id="CAI85595.1"
FT                   /translation="MKKYCLAAALSMACLAPAAQADTLLGLYVGVDGWKADNEGSFSYK
FT                   GNAPQDFNFDDETFVSYYAALEHPVPLVPNIKLRYTELELTGSTRLDKTFSFNGSDYVV
FT                   GTTVNSVSDLTHIDYTFYYEIFDNDLISIDLGVNAKQFDGEILVKGTTQQGGADYTETV
FT                   EFSGFVPLVYGRAEAGLPFTGLSVFFEGSFVAIDDSKVQDYQMGIAWEFIDNLAIDVAV
FT                   KAGYRSMTLELDDIDDINTNIDASGPFAGIQVHF"
     atgaaaaagt attgtttagc agcagccctt tcaatggcat gtttagcgcc tgcagcgcaa        60
     gctgatacct tattaggctt gtatgtaggt gttgatggct ggaaagcgga taacgaagga       120
     agcttttctt ataaaggaaa tgcaccacaa gattttaatt ttgacgatga aaccttcgta       180
     agctactacg ctgcacttga gcatccagtg ccattagtac ctaatattaa attaagatac       240
     acagagcttg agcttaccgg ctctacacgt ctggataaaa cattttcttt taatggttca       300
     gattacgttg taggtactac tgttaattca gtaagtgact taactcacat tgattacaca       360
     ttttattacg aaatctttga taacgactta atctctatcg atttgggtgt taacgctaag       420
     cagtttgatg gtgagatttt agttaaaggt actacgcaac aaggtggcgc tgattatact       480
     gaaactgttg agttttcagg ctttgtacca ttggtttacg gccgcgctga agcaggctta       540
     ccttttaccg ggttaagcgt gttttttgag ggcagctttg tagcaattga cgatagcaaa       600
     gttcaagatt accaaatggg tattgcatgg gagtttattg ataacctagc aatagatgtt       660
     gctgttaaag caggttaccg ctcaatgaca ttagagctag acgatattga tgatattaat       720
     actaatattg atgcatcggg tccatttgcg ggcattcaag tacactttta a                771
//

If you have problems or comments...

PBIL Back to PBIL home page