(data stored in ACNUC7421 zone)

EMBL: CR954246.PE482

CR954246.PE482       Location/Qualifiers
FT   CDS_pept        complement(520086..520973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0506"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85596"
FT                   /db_xref="InterPro:IPR021254"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG85"
FT                   /protein_id="CAI85596.1"
FT                   /translation="MAVKTAQARINLANTIESLLGYPIIKVGNNEASHNNEQSYGPQGK
FT                   VKPLYRINSDNTVLARAQKRQDLLLIKQQQNIETILAMAMDFCPDVASSKQPDADWVEH
FT                   FVALCGDTSNQSMQSLWAKILTGETLNPGTFSIKSLQTLKHMTQREADSLQKCVSLSGY
FT                   NEKDDSHFILLGFYKKPSLFDLLRKGNKVSLNLGKTGISFPDILTLMDLNLLYRKEIES
FT                   AVLKTGQELTLSFLSQKVTLKAKNSDLVLSYYKFTQTGDELSKLINYPVNKVYKQLLNS
FT                   ALESEFELAWHTTK"
     atggcagtca aaaccgcaca agcaagaatt aatctcgcta ataccataga gtcgttactg        60
     ggttatccta ttattaaagt aggcaataat gaggcatccc ataataatga gcaaagttat       120
     ggcccccaag gcaaggttaa accgctatat cgcattaata gcgacaatac cgttttagct       180
     agagcacaaa aaagacaaga cttactgctc attaaacaac agcaaaatat agaaacaatt       240
     ttagctatgg caatggattt ttgtcctgac gtagccagta gtaaacaacc cgatgccgat       300
     tgggtagaac actttgtagc actatgtggt gatacctcaa atcaatctat gcagtcactt       360
     tgggcaaaaa tactcaccgg tgaaacgctt aacccgggga ctttctcaat aaaaagtttg       420
     caaacactta agcatatgac ccagcgcgaa gctgactctc tacaaaagtg tgtatccctc       480
     tctggttata atgaaaaaga cgatagccac tttattttac tagggtttta taaaaaacca       540
     tcactatttg atttgttacg taagggcaat aaagtatctt taaatctagg aaaaacaggg       600
     attagctttc ctgatatatt aactttaatg gatttaaatt tactatatcg aaaagagatt       660
     gagtctgcgg tactaaaaac tgggcaagaa cttacgttat cgtttttatc acaaaaagta       720
     acgttaaaag caaaaaatag cgatttagta ttgagttatt ataagtttac gcaaacaggt       780
     gatgagctat ctaaactcat taactacccg gtaaataaag tgtataagca gttacttaat       840
     agtgcacttg agagtgaatt tgaactagcg tggcatacta ctaagtag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page