(data stored in ACNUC7421 zone)

EMBL: CR954246.PE483

CR954246.PE483       Location/Qualifiers
FT   CDS_pept        complement(520942..521502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0507"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85597"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG84"
FT                   /protein_id="CAI85597.1"
FT                   /translation="MLVQLLLVLLLLFIVIGLLLPQSYNVTKSININANTHIVKPLITD
FT                   FSQWHKWSPWKKLDPSVEFSLGEPSTGVGAHQSWQSKWGAGEMTTTALSANKMVLNILF
FT                   AQEHIIAANVIFTQNAKTVTVTFQITGQATLPLVSGYVAVLSEHILSNAVSLGLNNLKT
FT                   VAQLSDAQTIMESHGSQNRTSKN"
     atgttagtgc agcttttatt agttttactc ttacttttta tcgttattgg tctattacta        60
     ccacagagct ataacgtaac aaagagtatt aacattaatg ctaatacgca catagtaaaa       120
     cccttaatca ccgatttttc gcagtggcat aaatggtcgc cttggaagaa gctggatccc       180
     tctgtagaat tttccttagg tgagcctagc acaggggttg gtgctcatca atcatggcaa       240
     agtaaatggg gcgcaggtga aatgaccacc acagcgttaa gtgcaaacaa aatggtgttg       300
     aatattttat ttgctcaaga acacattatt gccgctaatg taatatttac gcaaaatgca       360
     aaaacggtca cggttacttt tcaaattacg gggcaagcca cgctaccttt agtttctggg       420
     tatgtggctg tgcttagtga gcacatttta agtaacgcag tatcactggg gctcaataat       480
     ttaaaaacag tagcgcagct aagtgatgca caaacaataa tggaaagtca tggcagtcaa       540
     aaccgcacaa gcaagaatta a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page