(data stored in ACNUC7421 zone)

EMBL: CR954246.PE484

CR954246.PE484       Location/Qualifiers
FT   CDS_pept        521804..523981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0508"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85598"
FT                   /db_xref="GOA:Q3IG83"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG83"
FT                   /protein_id="CAI85598.1"
FT                   /translation="MSTLKAKRALFSYPKYWAECYGTAPFLPTTREEMDALGWDSCDII
FT                   IISGDAYVDHPSFGMAVIGRVLEAQGFRVGIIAQPEWDSKEAFMALGKPNLFFGVTAGN
FT                   MDSMINRYTAEKRMRHDDAYTPDNIGGKRPDRAVIIYSQRCREAYKDVPLILGGIEASL
FT                   RRVAHYDYWQEKVRRSVLFDAKADILIYGNAERPLVEVAHRIAAGESTDTIQDVRGTAV
FT                   IRKEPLPGWRGSDSTAIDKIGKIDPIPNPYGADDVGCSKSEFKQAGIDLKAEAAKVITI
FT                   QPARPKPWEKTYVKLPAFEQVSVNKPLYAHASRIVHQETNPGCARAIFQRHGDRSIWVN
FT                   PPAYPLETHEMDAVFGLPYQRIPHPSYGDAKIPAYDMIKTSVNIMRGCFGGCSFCSITE
FT                   HEGRIIQSRSQESIIEEIEQIRDKVPGFTGVISDLGGPTANMYKLGCTSKKAESTCRRL
FT                   SCVYPEICKHMDTDHTPTIELYKKAREVKGIKKILIASGVRYDLAVQDPRYVKELVTHH
FT                   VGGYLKIAPEHTEDGPLSKMMKPGMGAYDQFKALFDKYSKEAGKKQYLIPYFISAHPGT
FT                   KDEDMVNMALWLKSNDFKLDQVQNFYPSPMANATTIYHTEMNSLRNIKNNTEVVPVPKG
FT                   ARQRRLHKAILRYHDPAGWPMIREALRKMGKANLIGKAPNCLVPEEGRDERAAKGSSRG
FT                   GRPALTRHTGFSQFHKANTKPKVASNRQRAK"
     atgagcacac ttaaagctaa gcgcgcctta ttctcatacc caaagtattg ggcagagtgt        60
     tatggcacag caccattttt acctactaca cgcgaagaaa tggatgcact tggctgggat       120
     agctgcgata taattattat tagtggcgat gcttatgtag atcatcctag ttttgggatg       180
     gcagtaattg gccgagtact tgaggcgcaa ggttttagag tgggtattat tgcccagcca       240
     gaatgggact ctaaagaagc gtttatggcg ctgggtaaac ccaatttatt ttttggtgta       300
     accgctggca acatggactc gatgattaac cgttatacag ctgaaaaacg catgcgccat       360
     gatgatgcct acacgccaga caatattggt ggtaaacgcc ctgatcgtgc ggtaatcatt       420
     tactcacaac gttgccgcga agcgtataaa gatgtaccac ttattttagg tggcattgaa       480
     gcaagtttac gccgtgttgc tcattacgat tattggcaag aaaaagtgcg tcgtagtgtt       540
     ttgtttgacg ctaaagccga tattttaata tatggtaatg cggagcgccc actggttgag       600
     gttgctcatc gtattgcagc gggcgaaagt accgatacca ttcaagatgt acgagggact       660
     gcggttattc gtaaagagcc gttaccaggc tggcgtggca gtgactctac cgctattgat       720
     aaaataggta aaattgatcc aattccaaac ccgtatggcg cagatgatgt tggctgtagc       780
     aaatcagaat ttaaacaagc aggtatagac ttaaaagccg aagccgccaa ggttattact       840
     attcagccag cgcgccctaa gccatgggaa aaaacctacg ttaaattacc tgcgtttgag       900
     caagtaagtg tgaataagcc attgtatgca catgcttctc gtattgtgca ccaagaaact       960
     aacccaggtt gtgctcgtgc tatttttcag cgccacggcg atcgttctat ttgggttaat      1020
     cccccagcat atccactaga aacacatgaa atggacgctg tatttggttt gccgtatcaa      1080
     cgtattcctc atcctagcta cggggatgca aaaatacctg cctacgacat gattaaaacg      1140
     tcagttaata ttatgcgagg ctgttttggt ggttgcagtt tctgttcgat taccgaacat      1200
     gaagggcgga ttattcaaag ccgttcgcaa gaatcaataa ttgaagaaat tgagcaaatt      1260
     agagataaag tacccgggtt taccggggtt atttctgact taggtggccc aacagccaac      1320
     atgtataaat tgggttgtac tagcaaaaaa gcagaaagta cctgtcgacg tttatcgtgt      1380
     gtataccctg aaatatgtaa gcatatggat accgatcata cgccaacaat tgagctgtat      1440
     aaaaaagccc gtgaagttaa aggcattaaa aaaatattaa tcgcctcggg tgtacgctac      1500
     gatttagccg tgcaagatcc acgttacgtt aaagaattag ttactcacca tgtaggtgga      1560
     tatttaaaaa tagcgccaga gcataccgaa gatggaccat tatcaaaaat gatgaagcca      1620
     ggtatgggag cttacgatca gtttaaagcg ttatttgata agtactcaaa agaagcgggt      1680
     aaaaaacagt atttaatccc atactttatt tcggcgcatc caggtactaa agacgaagac      1740
     atggtaaaca tggctttgtg gcttaagtcg aacgacttta aacttgatca ggtacaaaat      1800
     ttttacccat ctccaatggc aaatgcgacc actatttatc ataccgagat gaactcactg      1860
     cgtaatatta aaaataatac cgaagtagta cctgtgccga aaggtgcgcg ccagcgtcgt      1920
     ttacataaag caattttacg ctatcacgat cctgcgggct ggccaatgat ccgcgaagca      1980
     ctgcgcaaaa tgggtaaagc taacctaata ggtaaagcgc caaattgctt agtgccagaa      2040
     gaagggcgcg acgaaagagc tgcaaaagga agtagtcgag gtgggcgccc agcattaacg      2100
     cgccatactg gttttagcca atttcataag gccaatacaa aaccaaaggt agcgagtaat      2160
     cgccaaagag ctaaatag                                                    2178
//

If you have problems or comments...

PBIL Back to PBIL home page