(data stored in ACNUC7421 zone)

EMBL: CR954246.PE485

CR954246.PE485       Location/Qualifiers
FT   CDS_pept        complement(524121..524441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0509"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85599"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG82"
FT                   /protein_id="CAI85599.1"
FT                   /translation="MSRLKLTIALVSFCCLFLLACATKVSATTNMVVVSSLATQPNLQQ
FT                   SITHTLRTNPNLALSDIRVQVKNGEVDLYGKAQTGFERALAQKFLENMDGVKIIRNKID
FT                   II"
     atgagccgtt taaaattaac tatcgcttta gtatcatttt gttgtttgtt tttattagca        60
     tgcgctacaa aagtgagtgc tacaacaaat atggttgtcg ttagcagcct ggcaacccaa       120
     cctaacttac agcaatcgat tacccacact ttgcgtacca accccaattt agcgctaagc       180
     gatattcgcg tacaagttaa aaatggcgaa gtagatttat acggtaaagc gcaaacaggt       240
     tttgagcgtg cgttggcaca aaagttttta gaaaatatgg atggcgtaaa aatcattcgt       300
     aacaaaattg atattattta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page