(data stored in ACNUC7421 zone)

EMBL: CR954246.PE487

CR954246.PE487       Location/Qualifiers
FT   CDS_pept        525998..526696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0511"
FT                   /product="conserved protein of unknown function ; putative
FT                   SAM-dependent methyltransferase(yfiC)"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85601"
FT                   /db_xref="GOA:Q3IG80"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IG80"
FT                   /protein_id="CAI85601.1"
FT                   /translation="MSGFAFKQFKVAHEQCAMKVSTDGILLGAWANLSNANSLLDIGTG
FT                   TGLLALMCKQRSPQLTITAVEVDKNAYQQALQNIAASPWPNIEVHQQSIQTFNSAQPFD
FT                   VVIANPPYFNHSLKGNNKARNIARHTDGLSFAELISAFKKLSHAGSTFSLILPTTEVAV
FT                   FIELATQNGLFLNTHCQVKATPNKAISRSLMTFSYINQSIVESALCIKDNENNYSEDYI
FT                   ALCKAFYLKM"
     atgtctggtt ttgcatttaa acaatttaaa gttgcgcacg aacagtgtgc aatgaaggta        60
     tcaaccgatg gtattttgct tggagcatgg gctaatttaa gtaatgccaa cagcttgctc       120
     gatataggta caggcacggg attgctggcg cttatgtgca aacagcgcag cccccagtta       180
     actataacgg cggtagaagt tgataaaaat gcttaccaac aagcgttgca aaatattgcc       240
     gctagcccgt ggccaaatat agaggtgcac cagcaaagca ttcaaacttt taacagcgcg       300
     cagccatttg atgtagtgat agccaatccg ccgtatttta atcacagttt aaaaggtaat       360
     aataaggcgc gtaatattgc gcgccataca gatggtttaa gttttgctga gctaattagt       420
     gcttttaaaa agctcagtca tgcaggctca acctttagct taattttacc cactacagag       480
     gttgcggtgt ttattgaact tgctactcaa aacgggcttt ttttaaatac tcattgccaa       540
     gtaaaggcga cgccaaataa agcgattagc cgaagcctaa tgacctttag ctatataaac       600
     cagagcattg tggaatcagc tttgtgtata aaagataatg aaaacaacta tagcgaagat       660
     tatattgcgc tgtgcaaagc attttatttg aagatgtaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page