(data stored in ACNUC7421 zone)

EMBL: CR954246.PE488

CR954246.PE488       Location/Qualifiers
FT   CDS_pept        526749..527195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0512"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85602"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG79"
FT                   /protein_id="CAI85602.1"
FT                   /translation="MKKRTKSVLLSALAATFFTTQSVLASMTPVGLWKTIDEDTNEAKS
FT                   YVRIVENNGVLSGTIETLLNKDKQNAVCSQCSGDKKDQPILGMTIIDNVIDSGDGSWED
FT                   GQILDPNNGKSYTVRLTTQDAGEKLEVRGYIGFFYRNQYWLRVE"
     atgaaaaaac gaactaaatc agtattatta agcgccttag ccgctacatt ttttacaacg        60
     cagagcgtac ttgccagtat gacgcctgtt gggctttgga aaaccattga tgaagacact       120
     aatgaagcta agtcgtatgt ccgtatagtt gaaaataacg gggttttaag cggcaccatt       180
     gaaacattat taaataaaga taagcaaaat gcagtgtgct cgcagtgctc gggcgataaa       240
     aaagatcagc ccatattagg catgaccatt attgataatg tgatagatag cggtgatggt       300
     agttgggaag acggtcaaat actcgaccca aataacggta aaagctatac agtgcgctta       360
     acgactcaag atgctggtga aaaattagaa gtgcgtggtt atattggctt tttttatcgt       420
     aaccaatatt ggctaagagt agagtag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page