(data stored in ACNUC7421 zone)

EMBL: CR954246.PE49

CR954246.PE49        Location/Qualifiers
FT   CDS_pept        complement(55661..56116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0053"
FT                   /product="putative transcriptional regulator (LRP/AsnC
FT                   family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11230123, 12458218; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85163"
FT                   /db_xref="GOA:Q3IF05"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF05"
FT                   /protein_id="CAI85163.1"
FT                   /translation="MLDKKDQQLLIALQANARMSVADLASHISLSDTPCLRRIKKLEQA
FT                   SIITGYHAAINPKALKLNVLVYAFVRLNQNSASAARQFEQHVEKLTHVLECSVISGSYD
FT                   YLLKIIAHDLESYEQFVKHQLGSLSCIANIESTVVLKQSFSKKQLPL"
     atgctcgata aaaaagatca gcaattgctc attgccttac aagccaacgc tagaatgtct        60
     gttgcagatc ttgccagtca tattagcctc tcagatacgc cctgccttag acgaattaaa       120
     aagctagaac aagctagtat tattaccggc taccacgctg ctattaaccc caaggcactt       180
     aaactaaacg ttttggtgta tgcatttgta cgtttaaatc aaaattcggc cagtgctgcc       240
     cggcaatttg agcaacacgt agaaaagctc actcatgtgc tagagtgttc ggtaatatcg       300
     ggaagttacg actatttact aaaaataatt gcgcatgatt tagaaagcta tgagcagttt       360
     gttaagcatc aactagggag cttaagctgt atcgctaata tagaatcaac cgtggtgtta       420
     aagcagtctt ttagcaaaaa acaattacca ttataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page