(data stored in ACNUC7421 zone)

EMBL: CR954246.PE496

CR954246.PE496       Location/Qualifiers
FT   CDS_pept        535840..537015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0521"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85610"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD5"
FT                   /protein_id="CAI85610.1"
FT                   /translation="MFKTLFITLFFIFSATLILSVQADEAKGSIVVGAQQYTKYLPQLK
FT                   NKRVGLVVNQTSTVEKIHLVDSLREKNVNITKIFAPEHGFRGDHDAGAHVKNAVDSKTG
FT                   IPLISIYGNNKKPSAEVLADVDVIIFDIQDVGVRFYTYISSMHYMMEAAAEQEVEFIVL
FT                   DRPNPNIAYVDGPILEPQFKSFVGMHPIPVVHGMTVGELANMIKGEGWINQAAVLELNV
FT                   IPVSGYTRATSYSLPIKPSPNLPNDTAISLYPSLCFFEATPISIGRGTDFAFQVIGYSP
FT                   IALGEFSFTPRAIKGAALNPKFKNQAVQGLDLRQATTKGLDLSYLISAYKQLNNNDITF
FT                   FERADFMDKLAGTDKLRLAIEAGQSAQQIKQTWQAALMQFKQQRAPYLLYE"
     atgtttaaaa ccctatttat tacgttgttt tttattttta gcgctacttt aatactcagc        60
     gtacaagctg atgaagctaa aggttcaatt gttgtggggg cgcagcaata cacaaagtat       120
     ttaccgcagt taaaaaataa gcgcgtaggg ctggtggtta atcaaacatc aacagtagaa       180
     aaaatccatt tagtagatag cctgcgggaa aaaaacgtaa acataactaa aatatttgca       240
     cctgagcatg gctttcgtgg cgatcacgat gcgggggcgc acgtaaaaaa tgccgttgat       300
     agtaaaaccg gtattccact tatttccatt tacggcaaca ataaaaaacc gagcgccgaa       360
     gttttagctg atgttgatgt aataattttt gatattcaag atgtgggtgt gcgattttat       420
     acttatataa gctctatgca ttacatgatg gaagcagctg ccgaacaaga ggtggagttt       480
     attgtactcg acagaccaaa cccaaatatt gcttatgttg atgggcccat attagagcca       540
     caatttaagt catttgtagg tatgcacccc attcctgtag ttcatggtat gactgtgggc       600
     gagcttgcaa acatgatcaa aggtgaaggc tggataaatc aagcagctgt tttagagctt       660
     aatgtgatcc cagttagtgg ttatacacgc gcaactagct atagtttacc gataaagcca       720
     agccctaatt taccaaatga tactgctatt tcgctttatc catccttgtg cttttttgaa       780
     gccacgccaa ttagtattgg cagaggtacc gactttgcgt ttcaggttat agggtattca       840
     ccgattgctt taggggagtt tagttttacc ccgcgtgcta ttaaaggcgc ggccctaaac       900
     cctaaattta aaaaccaagc tgtgcagggg ctcgacttac gccaagccac cactaaaggg       960
     ttagatttaa gctacttaat aagtgcttat aagcagctta ataataatga tattacgttt      1020
     tttgagcgcg ctgattttat ggataagtta gcaggtaccg ataagctgcg cttagctatt      1080
     gaggcggggc aatcggcaca acaaataaag caaacttggc aggcggccct gatgcaattt      1140
     aaacagcaaa gagcacctta tttgttatat gagtaa                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page