(data stored in ACNUC7421 zone)

EMBL: CR954246.PE497

CR954246.PE497       Location/Qualifiers
FT   CDS_pept        537026..538687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0522"
FT                   /product="conserved protein of unknown function; putative
FT                   peptidase with beta-lactamase domain (partial match)"
FT                   /function="2.1 : Metabolism of carbohydrates and related
FT                   molecules"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85611"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD4"
FT                   /protein_id="CAI85611.1"
FT                   /translation="MYLYLKNKNYYSIKKLLIVALSFMLGACSSSVEPLEPKALLTQSK
FT                   LVELPNAQVIVTFPEPNPSSREYVNNRGTFKAYKGHGQLLIQNHSAKSADIYINNQLLN
FT                   IKQLLGANTVYQYSLAKLTHNGVNTFKVANIQPAGASLTLRFAFPTLNKASHQQANFSE
FT                   VDALIERDIKAGFPGAVLAVVKNGELIKLTAYGDAKQYQQNDLMLLRPEPMQTDTLFDL
FT                   ASNTKIFATNFALMKLVSEGLLNINKPVQLYLPEYQGDGREQRRVKDLLTHSAGYPPVF
FT                   DFHRKDSSNGDVFYSQNSHTTKKLLLTSVPLSEKSLGQHVYSDIDYMILGVLVERITGL
FT                   SLDDYLEQQVYAPLKLHNTVFNPLKKGFNAQQFAATELGGNTRDGRIKFDNIRTHVLQG
FT                   QVHDERAYYSLGGVAGHAGLFSNAPDLAILCQLLLNNGGYGDKQLFSASALAQFLTPQS
FT                   SDETYGLGFRLAGNNQARRWHFGPYASAQAYGHTGWTGTVTVIDPVYDLAIILLTNARH
FT                   TPITGSQKSYQFSGKNYETAQYGSVVSLIYEALLNQ"
     atgtacttat atttaaaaaa taaaaattat tacagtataa aaaagttatt aatagtggct        60
     ttaagtttta tgctgggggc atgtagctcc tctgtagagc cgctcgagcc caaggcgcta       120
     ttaacgcaaa gtaaacttgt tgagctgcct aatgcgcaag taattgttac ctttcctgag       180
     ccaaacccta gtagccgtga gtatgtaaat aatcgcggca cgtttaaagc ctataaaggc       240
     catgggcagc tgttaattca aaatcatagt gctaaaagtg ccgacattta tataaataat       300
     caactgctta atattaagca attgctcggc gctaatactg tgtaccaata tagtttagca       360
     aagctaacgc ataacggggt taacaccttt aaagttgcaa acattcaacc agcgggagca       420
     agtctaacgc tgcgctttgc gtttcctact ttaaataaag cgtcgcatca gcaggctaat       480
     tttagtgagg tagatgcatt aatagagcga gatattaaag cgggttttcc tggtgctgtt       540
     ttagcggtag taaaaaatgg tgagttaatt aaattaactg cttatggcga tgcaaaacag       600
     tatcaacaga acgatttaat gctattacgc ccagagccaa tgcaaactga taccttattt       660
     gacttagcct ctaatactaa aatatttgct accaactttg cattaatgaa gttagtaagc       720
     gaaggcctat taaatattaa taagccagtg caattatatt taccagagta tcaaggcgat       780
     ggtcgagagc agcgacgcgt aaaagattta ctcacgcata gcgcaggcta tccgccggtg       840
     tttgattttc atcgtaaaga cagtagcaat ggcgatgtgt tttactcaca aaatagccat       900
     actacaaaaa agctcttact taccagtgtg ccacttagcg aaaaatcgct cgggcagcat       960
     gtttattcag acattgatta catgatttta ggagtattgg ttgagcgtat aaccggtctt      1020
     tcacttgacg attacctaga gcaacaagta tatgcgccat taaaattgca taacactgtg      1080
     tttaaccccc ttaaaaaagg ctttaatgct cagcaatttg ccgccacaga gctgggtggt      1140
     aacacgcgag acggacgaat caaatttgat aatattcgca cccatgtttt acaaggccaa      1200
     gtacatgacg agcgtgcgta ctattctcta ggtggcgtag cagggcacgc ggggttattt      1260
     agtaatgcgc cagatttagc catactttgt cagctactat taaataatgg tggttacggc      1320
     gataagcagc tttttagtgc aagtgctttg gcgcagtttt taaccccaca aagtagcgat      1380
     gaaacctacg ggctgggctt taggcttgct ggtaacaacc aagcaaggcg ttggcacttt      1440
     ggcccttacg caagcgcaca ggcttatggg catacaggtt ggacaggcac agtaacggta      1500
     attgatcccg tttacgactt agcgattatt ttattaacta atgcgcggca tacgccaatt      1560
     acaggctcgc aaaaaagtta tcaatttagt ggtaaaaatt atgaaactgc acaatatggc      1620
     tcggttgttt cattaatata cgaagcgtta ttaaatcaat aa                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page