(data stored in ACNUC7421 zone)

EMBL: CR954246.PE498

CR954246.PE498       Location/Qualifiers
FT   CDS_pept        538892..540199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0523"
FT                   /product="putative Na+/H+ antiporter family"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85612"
FT                   /db_xref="GOA:Q3ILD3"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD3"
FT                   /protein_id="CAI85612.1"
FT                   /translation="MALLLAVASSEFLLALQGEGSSVFNTFLNTIERIVSVASSPGNTR
FT                   ILIFSILIGALLAYIRESGGVAATVNMLMNKGIAKSKRQVGFLTMFTGIAVFIESNLSV
FT                   LTAGILSRGLFDKFKMSRARLAYIIDSTSAPVCILILLNGWGAFVLGLLSNYELGESAV
FT                   SVLWGSVGYNFYAIITLVIVFYTIAFDKVHGPMKQAEQKLELQTTDLKEEVKGSKARFM
FT                   LVPLITLIVSMVGFMFYTGNGVLAEGSGSKSVLYATVLAIVVAYFLMLASRQFSHHKLV
FT                   ETGFKGMGELLPLVGIVLLSLTLGASLKELGTGVFVASLVGDYLPIYLVVPALFLTGAV
FT                   MSFTTGTSWGTFAILIPIGVPLIQALGLPPSLVLGAILGGGIFGDHCSPISDTSAVSAI
FT                   ASGCDLLTHVKTQLPYALFAGGLTLIAYLVTSIIVL"
     atggcgctgt tgcttgcagt ggcttcgtca gagtttttac tcgcattaca gggggagggc        60
     agtagtgtat ttaatacctt tttaaacact attgaacgta ttgttagcgt agcaagctcg       120
     cccggcaata cccgtatttt aatttttagt attttgattg gtgctttgct tgcctacatt       180
     cgcgagtcgg gtggagtagc cgctaccgtt aatatgttaa tgaacaaagg tatagcgaaa       240
     agtaagcgtc aagttggctt tttaactatg tttactggca ttgcggtgtt tatagagtca       300
     aacctgagtg tacttactgc aggtatttta tcgcgcggat tattcgataa atttaaaatg       360
     agccgcgccc gcttagctta tattatcgat agcaccagtg cgccggtatg tattttaata       420
     ttactaaatg gttggggcgc atttgtacta gggttattaa gtaactacga gttaggtgaa       480
     tcagctgtat cggtactttg gggcagcgta ggctataact tttacgccat aatcacgctt       540
     gttattgttt tttacaccat tgcgtttgat aaagtacatg gcccaatgaa acaagctgag       600
     caaaaactag agctacaaac aactgactta aaagaagaag taaaaggctc taaagcacgc       660
     tttatgttag tgccccttat tacgctgatt gttagcatgg tgggctttat gttttacaca       720
     ggtaacggtg tattggcaga aggtagtggc tcaaagtcgg tattgtatgc aaccgtttta       780
     gccatagttg tagcttactt tttaatgcta gcatcacgcc aatttagcca ccataagtta       840
     gttgaaacag gctttaaagg catgggcgaa ttactgccac tagtaggcat tgtattgtta       900
     tcgttaactt taggagcaag cttaaaagag ttgggcactg gtgtgtttgt ggcatcttta       960
     gtgggcgatt acctccctat ttacttggtg gtaccggcac tgtttttaac cggtgcggtt      1020
     atgtcgttta ctacgggtac atcgtggggc acctttgcaa ttttaatccc tattggcgtg      1080
     ccgcttattc aagcattggg tttgccgccg tcgttggtat taggcgctat tttaggtggc      1140
     ggtatatttg gcgatcactg ctcgcccata tccgacacca gcgcagtatc ggcaattgca      1200
     tcgggctgcg acttacttac tcacgttaaa acccagctac cctatgcctt gttcgctggt      1260
     ggcctgacac tgatagccta cttagtaacg agcataattg ttttataa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page