(data stored in ACNUC7421 zone)

EMBL: CR954246.PE499

CR954246.PE499       Location/Qualifiers
FT   CDS_pept        complement(540313..541461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0524"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85613"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ05"
FT                   /protein_id="CAI85613.1"
FT                   /translation="MLKLLFASSLIFSSCSVLSKNLTTEEQRIEAATHAMPQVLMAFAD
FT                   EVNQFEQQWKSLNNFRHATDLIADYSSQLWLNAKQRIVTTKNYDDRELYWARLLSSKII
FT                   RSVKPKFILSVAEQNNLLTQLEKGSRGHNDLSFTKGSTKKIILTGFDPFLLDKNINQSN
FT                   PSGVAALLLDGQVINYQGISAEINTVMVPVRYADFDQGIIEALLAPYYALNNVDMIVTV
FT                   SMGRKDFDLERFPGKRRSVTAPDNANIIFGGTQTAPLLPSLNNQPLPGNEFVQFSLPVA
FT                   NMQQAQGPYKVIDNHKITTLEKTYEPATLAELQNSIAVNGSGGGYLSNEISYRSIRLRN
FT                   QLNSTIPTGHIHTPRIQQFEPKTEAKIVKQITAMLEHSLNAL"
     atgcttaaac tactatttgc ttcaagttta attttttctt cttgctcggt tttgagtaaa        60
     aatttaacaa ccgaagagca acgaattgaa gccgctaccc acgccatgcc tcaggtgcta       120
     atggcctttg ctgatgaggt gaatcaattt gaacagcaat ggaaaagcct taacaacttt       180
     cggcatgcaa ctgacttaat cgctgattat tcaagtcaat tatggttaaa cgccaaacaa       240
     cgcattgtta caactaaaaa ctacgatgat cgcgagcttt actgggcacg attactttca       300
     agtaaaataa ttcgctctgt taagccaaaa tttatcctct cagttgctga gcaaaataac       360
     cttttaactc agttagaaaa aggcagtcgc ggtcataacg acctcagctt tactaaaggc       420
     agcactaaaa aaattatcct taccggcttt gacccctttt tattagataa aaacataaat       480
     caaagtaacc catctggggt tgctgccctc ttgctagatg gtcaagtaat taactaccaa       540
     ggcattagcg ctgaaattaa caccgttatg gtgcccgttc gttatgccga ctttgatcaa       600
     ggtataatcg aagcactcct cgcgccctat tacgccctga ataatgtcga tatgattgtt       660
     actgtaagca tgggtcgcaa agattttgat ttagaaagat ttcccggtaa gcgccgcagc       720
     gtaactgccc cagacaatgc caatattata tttggcggga cacaaacagc tcccttgctc       780
     ccaagtttaa ataaccagcc actgccaggt aacgaatttg tacaatttag ccttcccgtg       840
     gcaaatatgc agcaagcaca agggccgtat aaggttattg ataatcataa aatcactacc       900
     ttagaaaaaa cttacgagcc tgcaacactt gccgagctgc aaaatagcat tgccgtaaat       960
     ggctctggcg gtggatacct gtctaacgaa atttcgtatc gcagtatacg ccttcgtaat      1020
     caacttaatt caaccattcc aacaggccat attcacacac ccagaattca acagtttgag      1080
     ccgaaaacgg aagcaaaaat agtaaagcaa attaccgcaa tgctagagca cagcttaaat      1140
     gcgttgtaa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page