(data stored in ACNUC7421 zone)

EMBL: CR954246.PE50

CR954246.PE50        Location/Qualifiers
FT   CDS_pept        56254..57423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0054"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85164"
FT                   /db_xref="GOA:Q3IDE5"
FT                   /db_xref="InterPro:IPR015029"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE5"
FT                   /protein_id="CAI85164.1"
FT                   /translation="MSTHTAIFDRWIRSAFPQINSELEQLYWQQDDKANVEGLGEPLKQ
FT                   QLKDEGNALISNLLAEGNTDEGFDSAFDLLGNVGLFMAACRRHEITEPSRETTSPLVEA
FT                   SALAMHIGASIGVTPRFATAHLTTHNKALNGTYKRFTNLPDEKLFIDYNTQGILAYKRA
FT                   SDALLKILPLGISHPTCAELLKVAKQALIDVIESNNALYTQLDTERFFNCVRPYYKPHR
FT                   VGNEIYRGANAGDFAGINVIDMLLGLCSANEPSYSQMLVDKFLYMMPEDQQILREAMRM
FT                   QSFMDDFLQAQQYKDNDWFKYHAKLFIQVCKLHGDTAIGHHNQLVEKFIAQPSKQMQQQ
FT                   HMSKVTASGPPLHVLLDSLEKLRDKRASAKRDDIKTRYDDINLLKQWIK"
     atgagcaccc atacagccat ttttgatcga tggataagaa gcgccttccc acagataaac        60
     agcgagcttg agcaacttta ctggcaacaa gatgataaag ccaatgtaga ggggttggga       120
     gagcctttaa aacagcaatt aaaagatgaa ggtaacgcat taataagtaa tttattagcg       180
     gagggaaata ccgatgaagg ttttgatagt gcgtttgatt tactcggtaa tgtagggctt       240
     tttatggcgg cgtgtcgtcg tcatgaaatt accgagccaa gccgtgagac cacatcgcca       300
     ttggtagaag cgtcggcact agcaatgcat ataggtgcct ctattggagt aacgccacgc       360
     tttgcgactg cccatttaac cacgcacaat aaagcgctaa atggcacgta taaacgtttt       420
     actaatttac ccgacgaaaa actatttatt gattacaaca cccaaggtat tttggcatat       480
     aaacgcgcca gcgatgcatt attaaaaata ttaccattag gtatttcgca ccccacctgt       540
     gccgagctat taaaagtagc aaaacaagcg ttaatagatg taattgaatc gaataatgca       600
     ctttataccc agttagacac agagcgcttt tttaattgtg tgcgccctta ttataaaccg       660
     catcgagtag gcaatgagat atacagaggt gctaatgcgg gagattttgc cggcataaac       720
     gttatcgata tgctacttgg gttgtgtagt gccaacgagc caagttattc acaaatgctg       780
     gtggataagt ttttatatat gatgccagaa gatcagcaaa tattgcgcga agcaatgcgc       840
     atgcaaagct ttatggatga ctttttacag gcgcagcaat ataaagacaa tgactggttt       900
     aaataccacg caaagctatt tattcaggtg tgtaaattac atggtgacac tgcaatcggt       960
     catcataatc aattggttga aaaatttatt gcgcaaccgt caaagcaaat gcaacagcaa      1020
     catatgagta aagtaacagc cagtggccca ccattacatg ttttgctcga ttcgttagaa      1080
     aaactccgtg ataaacgtgc cagcgctaaa cgcgacgata taaaaacacg ttacgacgat      1140
     ataaacttgc taaaacagtg gattaaataa                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page