(data stored in ACNUC7421 zone)

EMBL: CR954246.PE500

CR954246.PE500       Location/Qualifiers
FT   CDS_pept        541691..542197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0525"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85614"
FT                   /db_xref="GOA:Q3IJ04"
FT                   /db_xref="InterPro:IPR021438"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ04"
FT                   /protein_id="CAI85614.1"
FT                   /translation="MQLIEINKARYRKHLNRVIAGCAVGLAVGSLAISQTLIALFPDES
FT                   GTHFHWNVAGVVISALGLAWLLNKYRTHPFMIEVVYVWELKQALNKITRKMAKLKAAGR
FT                   EGNSDALLAIHYSYAGSKLLWQLDDNTITMDDLAIKQAELDSVAAKYNLTLDANDYDAS
FT                   ILKNF"
     atgcaactca ttgaaataaa taaagcgcgt tatcgtaagc atttaaaccg tgttattgcc        60
     ggttgtgctg tgggtttagc tgttgggagc ttagctatat cgcaaacgct gattgctttg       120
     tttcctgatg agagcggcac tcactttcat tggaacgtag cgggcgttgt tattagcgca       180
     ttagggcttg catggttact taataaatac cgcacgcatc cgtttatgat tgaagtggtg       240
     tatgtgtggg agcttaaaca agcgcttaat aaaataacgc gtaaaatggc gaaattaaag       300
     gctgcagggc gtgaaggtaa tagtgatgcg ctattggcta ttcattacag ttacgcgggc       360
     tctaaattgt tatggcagct cgatgacaat acaatcacta tggatgactt agcaattaag       420
     caagctgagc tggatagtgt ggcggctaag tataatttaa cacttgatgc caatgactat       480
     gatgcaagta ttttaaagaa cttttaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page