(data stored in ACNUC7421 zone)

EMBL: CR954246.PE501

CR954246.PE501       Location/Qualifiers
FT   CDS_pept        542282..542935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0526"
FT                   /product="putative glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85615"
FT                   /db_xref="GOA:Q3IJ03"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ03"
FT                   /protein_id="CAI85615.1"
FT                   /translation="MSLIVYGVPLSPYVRKVCLCLAAKQLDYKLEIVSPFNQPAWFFEL
FT                   NPLGRIPALKDGDLVLADSSVICQYLDDKYTGNTALLGDTVEQTAQVRWLEKYADYELA
FT                   PLTTFTVFQQRVINLGMQKVCDESLVKLAMNEQLPPHFDYLEGVLGHNDYFVGNALTLA
FT                   DIAFASQIINMQHAGEQINAQRWPNLAALFERVKALPAMQTLLQSEQAMLASMQ"
     atgagtttaa ttgtttatgg cgtacctctt tctccttatg tacgcaaggt gtgtctgtgt        60
     ttggctgcaa agcagttaga ttataagtta gaaatagtgt cgccgtttaa tcaaccggct       120
     tggttttttg agttaaatcc attagggcgt ataccagcgc ttaaagatgg tgatttagtg       180
     ctggctgatt cgagtgttat ttgccaatac cttgatgata aatacacagg gaatacagca       240
     ttacttggcg acactgtcga gcagactgct caggtacgct ggttagaaaa atacgctgat       300
     tatgaacttg cgccgttaac tacttttact gtgtttcaac agcgagtaat taatttaggt       360
     atgcaaaaag tatgtgatga aagtttagta aagttggcta tgaatgagca gttaccaccg       420
     cactttgact accttgaagg cgtgctaggt cataatgatt actttgtagg taacgcgtta       480
     acccttgctg atatagcgtt tgcgtcgcag ataatcaata tgcagcatgc gggcgagcag       540
     attaatgcac agcgctggcc aaatttagct gcactttttg agcgtgtaaa agcattacca       600
     gcaatgcaaa ctttattaca aagtgagcag gctatgcttg cgtcaatgca atag             654
//

If you have problems or comments...

PBIL Back to PBIL home page