(data stored in ACNUC7421 zone)

EMBL: CR954246.PE502

CR954246.PE502       Location/Qualifiers
FT   CDS_pept        542990..543451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0527"
FT                   /product="putative low molecular weight phosphotyrosine
FT                   protein phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85616"
FT                   /db_xref="GOA:Q3IJ02"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ02"
FT                   /protein_id="CAI85616.1"
FT                   /translation="MKKILVVCLGNICRSPTAEAVLKKRAEQLGITVKVDSAGTIGHHE
FT                   GNSPDSRSMQAGEKRGYSFKGIYSRKVRSSDFTEFDLILAADKQNLADLTQRCPAHLQY
FT                   KLALFLEFGEQAVSAIPDPYYGGDDGFEKVLDLIEAASDKILAKLTANV"
     atgaaaaaaa tactggttgt gtgtttaggt aatatttgtc gatcgcctac agctgaagcg        60
     gtattaaaaa aacgtgctga gcagttaggt attaccgtta aagttgactc ggccggtact       120
     ataggtcatc acgaaggcaa ttcaccagat agccgatcta tgcaggcggg cgaaaaacga       180
     ggttatagct tcaaagggat ttattcgcgt aaagtgcgca gtagtgattt tactgaattc       240
     gatttgattt tagccgcaga caaacaaaat ttagccgatt taactcagcg ttgcccagca       300
     catttacagt ataaacttgc cctgttttta gagtttggtg agcaggctgt aagtgctatt       360
     cccgatcctt attatggtgg ggacgatggt tttgaaaagg tgctagattt aattgaagca       420
     gcaagtgata aaatattagc taaattaaca gccaatgttt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page