(data stored in ACNUC7421 zone)

EMBL: CR954246.PE503

CR954246.PE503       Location/Qualifiers
FT   CDS_pept        complement(543575..544672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0528"
FT                   /product="conserved protein of unknown function ; putative
FT                   TonB domain protein"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85617"
FT                   /db_xref="GOA:Q3IJ01"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ01"
FT                   /protein_id="CAI85617.1"
FT                   /translation="MKPHKLALLLSLNLSVITASAFASEATNANTAFSQAYQNYLSAVD
FT                   TNENIQQAAKLAYSLGAKVYGDNADNTANLAINYAKAISGFNQEDEAKRYELYKQAYNI
FT                   LANNHGESSVETIDALLGMASNTKSARQADSQLERIVDIAKELKKPRFVADMQFAAASL
FT                   LVKKFVPEKYRSAKHYAEEADEYYQANLPENAVERIKSDFLMASFDEGRKKYDSAITRL
FT                   NRIVTVFDNNLSYDHSAELSAHSKLIALYEKQGESEQATKHCLAIAKMVPWEESQEQTP
FT                   LYRVNPDYPMGKARQGKDGSVVMEFEVDTAGFVKNVSVLDSNGGVTFEHSAKKAVEQWR
FT                   YAPKFEDGIPVTAKTQVRLDFKINR"
     atgaaaccac ataaactcgc cttactgctt agccttaacc tttcagttat tactgcatcg        60
     gcttttgcaa gcgaagctac aaatgctaac actgcatttt ctcaagcgta ccaaaattac       120
     ttaagcgccg tagataccaa cgaaaacata caacaagctg ccaaactcgc ttactcttta       180
     ggtgctaaag tatatggcga taacgcagat aacaccgcaa atttagccat taattacgct       240
     aaagctatca gcggatttaa ccaggaagac gaagctaaac gctacgaact gtataaacag       300
     gcgtacaata ttttagctaa caatcatggt gaaagctcag tcgagacaat agacgcctta       360
     ctaggtatgg caagcaatac taaatcagcg cgtcaggccg atagccaatt ggaacgtata       420
     gttgatatag caaaggagct taaaaaacca agatttgtag ccgacatgca atttgctgca       480
     gcctctttgt tagttaaaaa gtttgtgcca gaaaaatacc gttctgctaa acactacgcc       540
     gaagaagctg acgagtatta ccaagcaaac ttacctgaaa acgctgtaga gcgtatcaaa       600
     tcagattttt taatggcctc gtttgatgaa ggtcgtaaaa aatatgattc agcaattaca       660
     aggttaaacc gcatagtcac cgtatttgat aataacttaa gctacgatca cagcgccgag       720
     ctaagcgctc actctaagct tatagcacta tacgaaaagc aaggcgaaag tgagcaagca       780
     actaagcact gcttagctat tgctaaaatg gtgccttggg aagaaagcca agaacaaacc       840
     ccgctttatc gtgttaatcc tgactaccct atgggcaaag cacgccaagg taaagatggc       900
     agtgtagtta tggaatttga agtagacacc gcaggctttg ttaaaaacgt gagtgtgctt       960
     gattcaaatg gcggcgtaac ttttgagcac tcggcaaaaa aagcagtaga gcaatggcgc      1020
     tatgctccta aatttgaaga tggcatacct gtaacagcaa aaacccaagt acggctcgac      1080
     ttcaaaatta accgataa                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page