(data stored in ACNUC7421 zone)

EMBL: CR954246.PE505

CR954246.PE505       Location/Qualifiers
FT   CDS_pept        545564..546352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0530"
FT                   /product="putative membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85619"
FT                   /db_xref="GOA:Q3IIZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIZ9"
FT                   /protein_id="CAI85619.1"
FT                   /translation="MSTQLRVFKADAALKWFKAGWLIFKTQPLTFIFMHLFIGIVGLLS
FT                   LFLPLLQVVAALATPFLTAGFYQAVLTKQQGGKIMLADILKPITTKGNRLGLLRLALYQ
FT                   MGAGILMALLANGLFADAIAVMAQPDLDPNMAISQMLESISMASVVLFLLALSVYLTAF
FT                   AYAVPLVYFNKEQRIFSALKKSFMVFYYNILPLSVYAIICGLFIVLSMFLSFLPLLVLM
FT                   PICYISFFVSYQAIFMPVVPPSDDSNITPLSSESSGRFDA"
     atgtctacac aattacgagt ttttaaggcc gatgctgccc taaagtggtt taaagcgggc        60
     tggcttattt ttaaaaccca gccgcttact tttattttta tgcatttatt tattggtatt       120
     gttggcctgt tgtcgttatt tttaccgcta ttacaagtgg tagcggcttt agctacgcca       180
     tttttaaccg caggatttta tcaggctgtg cttactaagc agcaaggcgg taaaattatg       240
     ctcgctgata ttctcaagcc cattaccact aaaggtaatc gtttaggttt actgcgtttg       300
     gctttgtacc aaatgggtgc gggtatttta atggcattat tagcaaacgg tttatttgcc       360
     gatgcaattg cggttatggc gcagccagat ttagatccta atatggcaat tagccaaatg       420
     ttagagagta tttctatggc aagcgtggtg ctatttttat tagcgttgtc ggtttattta       480
     actgcattcg cttacgcggt tccattagtt tactttaata aagaacagcg catttttagc       540
     gctcttaaaa aatcctttat ggtgttttat tataatattt taccgctaag cgtttatgct       600
     attatttgcg ggttatttat tgtgctttcg atgtttttat cgttcttacc cttgttggtt       660
     ttaatgccta tttgctacat tagctttttt gtatcttatc aagctatttt tatgccggtt       720
     gtaccaccaa gtgacgatag caatattacg ccattaagta gtgaatctag tgggcgtttt       780
     gacgcttaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page