(data stored in ACNUC7421 zone)

EMBL: CR954246.PE51

CR954246.PE51        Location/Qualifiers
FT   CDS_pept        57425..58549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0055"
FT                   /product="putative pyridoxal phosphate dependent enzyme;
FT                   may have an iron-sulfur cluster"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85165"
FT                   /db_xref="GOA:Q3IDE4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE4"
FT                   /protein_id="CAI85165.1"
FT                   /translation="MNQHDFCMAEGCYLLSHSVGRPLKNSQQHLAAHYFSPWESSNKEP
FT                   WQQWLPAVEQFNTALGQLFNAPSEQFCPQVNLSSGLTKLLMSHPRLQQKNCKVLMTQSD
FT                   FPSMGFAMQKALPKCAQITFIPEHENLTDITVWQRYLTDNIDLVFISHVYSNTGVQAPV
FT                   HDIVALSKKTNSLSIIDVAQSAGVIPLDLTALNADFMIGSSVKWLCGGPGAAYLWVNPQ
FT                   QIAVCEPKDVGWFSHQNPFEFDINHFIYNKGALKFWGGTPSVVPYIIAANSIAYFAALG
FT                   IDKVRSHNLAMLALIQQQLGKYVVSPTQQHQCSGTAILNFNMQQQHVLNELNSAGISVD
FT                   ARKLGIRVSPHIYNSADAIHKFIAVIKKAIKVVD"
     atgaatcaac acgatttttg tatggccgaa ggctgttatt tattaagcca ctcagtaggg        60
     cgtccactga aaaatagtca gcagcattta gcggctcatt atttttcgcc gtgggaatcg       120
     tcaaataaag aaccctggca gcaatggtta cctgcagtag agcaatttaa taccgcatta       180
     gggcagttat ttaatgcgcc tagcgagcaa ttttgtccac aagttaactt atccagcggc       240
     ttaaccaaat tgttaatgtc gcatccgcga ttacagcaaa aaaattgcaa agtattaatg       300
     acgcaaagcg actttccaag tatgggcttt gcgatgcaaa aagctttgcc aaaatgcgcg       360
     caaataacat ttattcctga acatgaaaac ttaacagata ttaccgtttg gcagcgttat       420
     ttaacggata acatagattt agtttttatc agtcacgtat attcaaatac aggggtacaa       480
     gcccctgtac acgatattgt tgctttgagt aaaaaaacga atagcttatc aatcattgac       540
     gttgcgcaat ctgcaggggt gataccgctt gatttaaccg ccttaaatgc tgactttatg       600
     attggctcta gcgttaaatg gctatgtggc ggccctggtg ctgcttactt atgggttaac       660
     ccacagcaaa tagctgtttg tgagcctaaa gatgttggct ggttttctca tcaaaatccc       720
     tttgagtttg atataaatca ttttatttat aacaagggag cgcttaaatt ttggggcggt       780
     actccctcag ttgtacctta tattattgca gccaatagta ttgcctattt tgccgcattg       840
     ggaattgata aagttaggtc gcataattta gcaatgcttg cgcttattca gcaacagttg       900
     ggtaaatatg ttgtgtcgcc cacgcagcag catcaatgca gtggtactgc tattttaaac       960
     tttaacatgc agcaacaaca tgtattgaat gagcttaata gtgcagggat tagtgtggat      1020
     gccagaaagc ttggtatacg agtttcaccg catatatata atagcgccga cgcaatacat      1080
     aagtttatag cggttataaa aaaagcgatt aaggttgttg actaa                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page