(data stored in ACNUC7421 zone)

EMBL: CR954246.PE510

CR954246.PE510       Location/Qualifiers
FT   CDS_pept        complement(550981..551448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0535"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85624"
FT                   /db_xref="GOA:Q3ILF0"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILF0"
FT                   /protein_id="CAI85624.1"
FT                   /translation="MTLTTTYTLDKPYFYECFDESVAHSKRAQPKYFLLALLVALGLFG
FT                   IYGLDDHYLGSFLIMVAVLECIAFYYRRPWWVTRQMLSKASGSEVTLTFDEEGIKSSNF
FT                   YKNTQLLWSDINEVITTERGILLKNKKGMQYISKHILTAETLNFIHKKATQ"
     atgacactta caacaaccta cacgcttgat aagccttatt tttatgagtg ctttgacgaa        60
     tcagttgcgc atagcaagcg cgcgcaacca aaatactttt tattggcgct attagtagca       120
     ctcggtttat ttggaattta tggtctagac gatcattacc taggatcttt tctgatcatg       180
     gttgcggtac tcgaatgtat tgccttttat tatcgccgtc cttggtgggt tactagacaa       240
     atgctaagca aagcctcggg gtctgaggtc acccttacct ttgacgaaga agggattaaa       300
     tcgagtaact tttataaaaa cacccaactt ctgtggtcag atattaacga agttataacc       360
     acagagcgcg gcatactatt aaaaaacaaa aaaggtatgc agtatatatc caagcacata       420
     ttaactgccg aaacacttaa ttttatacac aaaaaagcca ctcagtga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page