(data stored in ACNUC7421 zone)

EMBL: CR954246.PE512

CR954246.PE512       Location/Qualifiers
FT   CDS_pept        complement(551907..552077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0537"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85626"
FT                   /db_xref="GOA:Q3ILE8"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILE8"
FT                   /protein_id="CAI85626.1"
FT                   /translation="MLRWTITFLVIALIAAVLGFGGIAGAAAGIAKIIFFIFLILLVIS
FT                   LVSGALRGKKP"
     atgttacgct ggacaatcac ttttttagta attgctttaa ttgctgcagt gttaggtttt        60
     ggtggtatag caggcgccgc agcgggtatt gcaaaaatta tattttttat atttttaata       120
     cttttagtta tatctttagt atcgggtgcc ctacgtggca aaaagcccta g                171
//

If you have problems or comments...

PBIL Back to PBIL home page