(data stored in ACNUC7421 zone)

EMBL: CR954246.PE516

CR954246.PE516       Location/Qualifiers
FT   CDS_pept        556034..557005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0541"
FT                   /product="putative oxidoreductase, Aldo/keto reductase
FT                   family"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85630"
FT                   /db_xref="GOA:Q3ILE4"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE4"
FT                   /protein_id="CAI85630.1"
FT                   /translation="MHDTPLAKYLPNVSKLIFGCMGLGGGWNKDPLTNTHTQQAHVCID
FT                   TAIAGGINLFDHADIYTFGKAEQVFGQVLKQRPELREQIYIQSKCGIRFADEQGPKRYD
FT                   LSKQWIEQSVEGSLKRLNTDYLDVLMLHRPDPLIQVEEVAQVFSRLKESGKVRHFAVSN
FT                   MSQQQIQFLQTALDMPIVANQIEASLKQSAWVDEGVYVGNRDGKDINFTPGFIEYCTEQ
FT                   EIQIQSWGSLCQGLYSGKQLQNASPADINTAILVAKLAALYRTSAEAIVLAWLLRHPAL
FT                   IQPVIGTTNAKRLAASCSAVNIELTREHWYALYVSAKGHELP"
     atgcatgaca ctcctttggc aaaatattta cctaatgtta gcaagctcat atttggttgt        60
     atgggacttg ggggaggctg gaataaagac cccttaacta atactcatac ccagcaggca       120
     catgtttgta tagatacagc aatagccggt ggcattaatc tttttgatca cgccgatatt       180
     tatacatttg gtaaagctga gcaggtgttt ggccaagtcc ttaagcagcg cccagagctg       240
     agagagcaaa tttatatcca gtcaaagtgc ggaattcgtt ttgccgatga gcaagggcca       300
     aagcgctacg acttatcaaa gcaatggatt gagcaatcag tagagggctc tcttaagcgg       360
     ttaaatactg attatttaga tgtacttatg ctgcacagac ccgacccttt gatacaagtt       420
     gaagaagtag ctcaggtatt tagtcgctta aaagaaagtg gcaaagtacg tcattttgcg       480
     gtgtctaata tgtcgcagca acaaatacag tttttacaaa cagcccttga tatgcccata       540
     gttgccaacc aaattgaagc aagcttaaag caatcagcct gggttgatga gggggtatat       600
     gtcggtaacc gcgatggcaa agacattaac tttactcccg gctttataga atattgcacc       660
     gagcaggaaa tacaaattca aagctggggt agcttatgcc aaggattata ttcaggaaaa       720
     cagctgcaaa atgcatcacc agcagatatt aataccgcta tattagtggc taagttagca       780
     gcactttata gaacgtctgc cgaggctatt gtattggctt ggttactgcg ccatccggca       840
     ttaattcaac cggtaatagg cacaactaat gctaagcgac tggctgcatc gtgcagcgct       900
     gtaaatatag aattaacccg agagcattgg tatgcattat atgtcagcgc caaagggcac       960
     gagttaccct aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page