(data stored in ACNUC7421 zone)

EMBL: CR954246.PE518

CR954246.PE518       Location/Qualifiers
FT   CDS_pept        complement(557303..558616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0544"
FT                   /product="putative peptidase, M23/M37 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85632"
FT                   /db_xref="GOA:Q3ILK0"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILK0"
FT                   /protein_id="CAI85632.1"
FT                   /translation="MVHVVHTLPKKHKLLILGLVSAIAGLAFLPSEKATASKDNSENTL
FT                   EIGKRYELQVKVDDNEKLTALNSEQAADKLPEYDFVDHQVKNGDNLAIIFKRAGFSAQT
FT                   LHKLINTNAETRKLTKIHPGETLSFATAKDGDLAQLRYVISKTDTLFVTLNDEGQYDTS
FT                   IDSKEIETLTKTVGGEISSSFWTSAIAAGLSERQIMNFADIFGWDVDFANDIRKGDGFG
FT                   LIYESHYVDGEFIGTGKIIAAEFVNQGQRYAAIRHTDGSFYTPEGRSMKKAFLRAPVSF
FT                   KYISSSFNPRRLHPVTGQVRAHRGIDFAARTGTPVVASGNGKVIKSGYSKYNGNYVFIS
FT                   HGTQYVTKYLHLNKRLVKTGQKIKQGEQLGTVGSTGRVTGAHLHYEFLVNGVHRNPKTV
FT                   KLPKSEPLPRAELAKFKPIADNFIAQLERNRELQLALK"
     atggttcacg tggttcacac gctccccaaa aaacacaaat tgcttatttt aggcttagtt        60
     tctgctattg ctggcttagc ttttctccct tctgaaaaag ccactgcatc caaagacaat       120
     agtgaaaaca cgctagaaat tggcaagcgc tatgagttac aagttaaagt tgatgacaac       180
     gaaaaattaa ctgcgttaaa ctcagagcaa gcagcagaca agctgccaga atacgacttt       240
     gttgatcacc aagtgaaaaa tggagataac ttagctatta tttttaaacg tgctggcttt       300
     tcagctcaaa cgttacataa attaattaac actaacgcag aaactcgcaa acttactaaa       360
     attcacccgg gtgaaacact gagttttgcc accgcaaaag atggcgattt agcacagctg       420
     cgttacgtta tttcaaaaac agacacttta tttgttacct taaacgatga agggcaatac       480
     gacacttcaa tcgatagtaa agaaatagaa acactaacta aaacagtagg cggcgaaatt       540
     tctagtagct tttggacttc agcaatagct gcaggtttaa gcgagcgcca aataatgaac       600
     tttgccgata tatttggttg ggatgtagat tttgctaacg atattcgcaa aggcgatggg       660
     tttggtttaa tttatgaatc tcactatgta gatggtgagt ttattggtac tggtaaaatt       720
     attgctgcgg aatttgttaa ccaaggccag cgctatgctg caattcgcca cactgacggt       780
     agtttttata ctcctgaagg gcgcagcatg aaaaaagcat ttttacgtgc accagttagt       840
     tttaaatata taagctcaag ctttaacccg cgacgtttac acccagtaac ggggcaagtt       900
     agagcgcatc gcggtataga ctttgcggcg cgcactggca cgccggtagt tgcctcaggt       960
     aacggtaaag ttattaaatc gggttacagt aaatataatg gtaactatgt atttattagc      1020
     catggcacac agtacgtaac taagtacttg caccttaata aacgcctagt aaaaacaggg      1080
     caaaaaatta agcaaggtga gcaactcggt actgttggct ctactggtcg tgtgaccggt      1140
     gcacacttac actatgaatt tttagttaat ggtgttcatc gtaatcctaa aaccgttaaa      1200
     ttacctaagt cagagccgct gccacgtgca gagcttgcca agtttaagcc tattgctgat      1260
     aactttattg cccagttaga gcgcaaccgc gaactacagt tagcacttaa gtaa            1314
//

If you have problems or comments...

PBIL Back to PBIL home page