(data stored in ACNUC7421 zone)

EMBL: CR954246.PE52

CR954246.PE52        Location/Qualifiers
FT   CDS_pept        complement(58533..59021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0056"
FT                   /product="putative RNA binding protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85166"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE3"
FT                   /protein_id="CAI85166.1"
FT                   /translation="MIRVILLSICLTAPTFSLAENITVYKCVIKGVPTFSQLPCALDAQ
FT                   AITLKNINVTTAYSDTTASSKITDTSVDDYLKTQQINRDIKRYQLAIKQYQQQYTEKKQ
FT                   QIDYMTQDKANRLGASSIANAIATKTSALKQSYDALIGQAQQQIEALNQQKEQLSQQP"
     atgatccggg ttatattgct atcaatttgc ttaaccgcgc caacctttag cttggcagaa        60
     aacattactg tttataaatg cgttattaaa ggtgttccta catttagcca gctgccctgt       120
     gctctagatg cacaagccat tacgctaaaa aatattaatg taaccacagc ctatagcgat       180
     acaactgcta gcagtaaaat aacagatact tctgttgatg attacttaaa aacgcagcaa       240
     attaatcgtg atataaaacg ctaccaactg gctattaaac aatatcagca gcaatacaca       300
     gaaaaaaaac agcaaattga ttacatgacg caagataaag ccaatcgttt aggggcttcc       360
     tctattgcca atgcgattgc aactaaaaca tcagctctta aacagtcata cgatgcttta       420
     attgggcaag cacagcaaca aatagaggcg ttaaatcagc aaaaagagca acttagtcaa       480
     caaccttaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page