(data stored in ACNUC7421 zone)

EMBL: CR954246.PE520

CR954246.PE520       Location/Qualifiers
FT   CDS_pept        complement(560414..561358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0546"
FT                   /product="putative cobalamin biosynthesis protein"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85634"
FT                   /db_xref="GOA:Q3ILJ8"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ8"
FT                   /protein_id="CAI85634.1"
FT                   /translation="MLSNMVQNHLDFIVFIMALLAERFLPLVSWYHPNTALTAIFSAIG
FT                   KRIYKVAEPNSYQYLAATLASTLILSVVLIIIVLLLEFAFYPELLAGLILYLCLESKAI
FT                   DKKALRIAKLTKQNQKSAARELLKPLVARDVTKLSGAGIIKALIESLILRTARYYFVVI
FT                   FVFLVLGPIAALAYRLLTLIEQAWRSNIKPNSPFLKPLKITLFIIEFIPMRLLALTIAA
FT                   SKASKLSMHYIKHYGRHFYQTNTGWLLSTCSASLGVQLGGPAVYFGERFNKMRIGTERL
FT                   PIAEDVPITINRLNQARVFWLLVVVCIEILKNI"
     atgctcagca atatggttca aaatcacttg gactttattg tgtttataat ggcgctcctt        60
     gctgagcgct ttttaccact tgttagttgg tatcatccta acactgcttt aacggctatt       120
     tttagcgcta ttggtaagcg tatttataaa gtagcagaac ccaatagcta tcaatattta       180
     gccgcaaccc ttgccagtac acttatttta agtgtggtac ttattattat tgtattacta       240
     ctggaatttg cattttaccc tgaattactc gccgggctta ttttatattt atgccttgag       300
     agtaaagcta ttgataaaaa agcactacgc attgctaagc ttaccaaaca aaaccaaaaa       360
     tctgccgccc gtgagctatt aaagccatta gtagcccgag acgttactaa actctctggt       420
     gcaggcataa ttaaagcctt aatagagagc ctaatattac gtactgcaag atattacttt       480
     gtggtgatat ttgttttttt agtacttggc cctattgcag cgcttgccta tcgattactt       540
     actttaattg agcaggcatg gcgcagtaac attaaaccca acagcccttt tttaaagccg       600
     cttaaaatta ccttgtttat tattgaattt attcctatgc gcttattggc actgactatt       660
     gcagccagta aagcgagcaa gctaagcatg cattatataa agcattatgg caggcacttt       720
     tatcaaacta atactgggtg gcttttaagc acttgctctg catcattagg cgtacaacta       780
     ggcgggcctg cagtgtattt tggcgaacgt tttaacaaaa tgcgtattgg taccgaacgc       840
     ctccctattg ctgaggacgt gccgattact attaatagac taaatcaagc acgggtattt       900
     tggttactgg tcgttgtttg catagaaata cttaaaaaca tttag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page