(data stored in ACNUC7421 zone)

EMBL: CR954246.PE522

CR954246.PE522       Location/Qualifiers
FT   CDS_pept        complement(562174..562770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0548"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85636"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILJ6"
FT                   /protein_id="CAI85636.1"
FT                   /translation="MEFALLSILVLVVGASVVASKFNDDGGNPYPFTRKQNVFTQVESA
FT                   FLNLLERAVGDQYKIVSRVKLIDVIDCKQGLSAKSKRAAMAKAKNKQLDFVLVDKEKMT
FT                   IVAAVDLVNNANKDGHKAQRDWFVNGALEAAGIPHIRMKVKSGYRPSEVRDAIMFKLGK
FT                   PAATQTARPIRTRVQKPAVLSPSQAKAHSTALAEI"
     atggaattcg ctttattatc aattttagta ttagttgttg gggcctctgt tgttgcgtca        60
     aagtttaacg atgatggcgg aaacccttat ccttttaccc gcaagcaaaa tgtatttact       120
     caagtagaaa gtgctttttt aaatttatta gaacgcgcag tgggcgatca gtataaaatt       180
     gttagtcgtg taaaactaat cgacgtgatt gattgcaaac aaggtttatc ggcaaagtct       240
     aagcgtgcag caatggctaa agctaaaaat aaacagcttg attttgtgct agtcgataaa       300
     gaaaaaatga ccatagtggc agccgtagac ttagtaaaca atgccaataa agatggccat       360
     aaagcacaac gcgactggtt tgttaatggc gcattagagg ccgctggcat cccgcatatt       420
     cgtatgaaag taaaatcagg ctatcgccca agtgaagtac gcgacgctat tatgtttaaa       480
     ctcggcaaac ctgcggctac gcaaacagct cgccctattc gtacccgagt tcaaaaacca       540
     gcggtactat caccttctca agctaaagcg cactctacag cactagccga aatttaa          597
//

If you have problems or comments...

PBIL Back to PBIL home page