(data stored in ACNUC7421 zone)

EMBL: CR954246.PE523

CR954246.PE523       Location/Qualifiers
FT   CDS_pept        complement(562886..563806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0549"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85637"
FT                   /db_xref="GOA:Q3ILJ5"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILJ5"
FT                   /protein_id="CAI85637.1"
FT                   /translation="MQTNMPDIANTAPALQTGTLDWVGMGEIELPFIFESHGITPVTVN
FT                   AKARAFVNLHKEDAKGIHMSRLFLALDTLSTEQQVNPQTLAQALDFFISSHEGLSDKAL
FT                   IEFKFELPLRRKSLLSDKAGWKSYPVILTSTIEQGVINYELSVDVTYSSTCPCSAALAR
FT                   QLIQNAFAEKFSQETLSQKEALEWLGTTQGIVATPHSQRSIANVKVKLDSNITQFDVVN
FT                   LINTIEDELKTPVQAAVKREDEQEFARLNGQNLMFCEDAARKIKALLETQQYSDYWLQI
FT                   NHYESLHAHDALAIAVKGVAGGYRA"
     atgcaaacta atatgcccga tatagctaac acggctcccg ccttacaaac tggtacatta        60
     gactgggtgg gaatgggtga aattgaactg ccatttattt ttgagtcgca tggcataacg       120
     ccagttactg ttaatgctaa agcccgcgct tttgtaaact tacacaaaga agatgcaaaa       180
     ggcattcata tgtcgcgctt atttttagcg ctcgacacgc tctctactga gcagcaagtt       240
     aatcctcaaa cattggctca agcgctcgat ttttttatta gtagccacga aggcttaagt       300
     gataaagcac ttatagaatt taagtttgaa ttaccactgc gccgtaaatc gttattaagc       360
     gataaggctg gctggaaaag ctaccctgtt atattaacca gcacaattga acaaggtgtt       420
     attaattacg agctaagtgt tgatgtaacc tattcatcaa cttgcccatg ttcagcggca       480
     cttgcgcgtc agctgataca aaatgcattt gccgaaaaat tcagtcaaga aaccctcagt       540
     caaaaagaag cactagaatg gctaggtact acgcaaggta ttgtagccac cccacactcg       600
     cagcgctcaa ttgctaatgt aaaagtaaag ctcgacagta atattactca atttgacgta       660
     gttaatttaa ttaacacgat tgaagatgaa ttaaaaacgc cagtacaagc ggcagtgaaa       720
     cgtgaagatg aacaagagtt tgcccgccta aatggtcaaa atttaatgtt ttgtgaagat       780
     gctgctcgta aaattaaagc gctactagaa acacagcaat acagtgatta ctggttacaa       840
     ataaatcatt acgaatcgct gcatgcacac gacgcactcg ctattgcagt taaaggcgtt       900
     gctggcggtt atagagctta a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page