(data stored in ACNUC7421 zone)

EMBL: CR954246.PE529

CR954246.PE529       Location/Qualifiers
FT   CDS_pept        570931..571203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0555"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85643"
FT                   /db_xref="GOA:Q3ILI9"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILI9"
FT                   /protein_id="CAI85643.1"
FT                   /translation="MARTVFCQKLQKEAEGLGFQLYPGEIGEKIFNNISKEAWAQWQHK
FT                   QTMLINEKHLNMMDPEHRSFLEQQMVGFLFENKEVEIEGYKPPEK"
     atggcacgta cagtattttg tcaaaagtta caaaaagaag ctgaagggct tggatttcaa        60
     ttatatcctg gcgaaatagg cgaaaaaatc tttaacaata tctctaaaga ggcttgggcg       120
     cagtggcagc acaagcaaac aatgctgatt aacgaaaagc atttaaatat gatggaccca       180
     gagcatcgta gctttttaga gcagcaaatg gttggttttt tgtttgaaaa caaagaagta       240
     gaaattgaag gctacaaacc accagaaaag taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page