(data stored in ACNUC7421 zone)

EMBL: CR954246.PE53

CR954246.PE53        Location/Qualifiers
FT   CDS_pept        complement(60483..61412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0058"
FT                   /product="putative integral inner membrane protein;
FT                   putative exporter"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85167"
FT                   /db_xref="GOA:Q3IDE2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE2"
FT                   /protein_id="CAI85167.1"
FT                   /translation="MKSAALYITTVLIWGSTWLAIEFQLGDIAVELSLFYRFAIAALLM
FT                   WLYVAYKKPKMRFNLVDHGFFVLLALFNFGLNYLMLYWAQNHLSSAMTSIAFSMLLVMN
FT                   IVNTRLFFGKPISKRIYTGAVLAILGITCLFWPQLQQLNLSNSAFVGLLLALGGTFVAS
FT                   LGNMVSVRNSRKQIGVLQGNAWGMLYSAIGLALYVFISDVQFNFTAPTSYWLSLLYLSI
FT                   FGTVIAFACYFALLKNIGPEKASYVIVLFPLVAVTLSSFYEGFEWHANTFAGFSLVLLG
FT                   NAIVLTPTKRINAFLANRAVARRGSVPS"
     ttgaaaagtg cagcgctata tataacaact gttttaattt ggggctcaac ctggttggcc        60
     atagagtttc agctaggcga tattgctgtt gaactatcgc tattttatcg ttttgcaatc       120
     gcggcattat taatgtggtt atatgtggca tacaaaaaac ctaaaatgcg atttaattta       180
     gtcgatcatg gttttttcgt attattggcc ctgtttaact ttggcctaaa ttacttaatg       240
     ctttactggg cacaaaatca ccttagctct gcaatgacct cgattgcttt ttcaatgcta       300
     ttagtaatga atatagttaa tacccgatta ttttttggca aacctatttc aaaacgaatt       360
     tataccggtg ctgtacttgc cattttaggt atcacctgct tgttttggcc acaattacag       420
     caactcaact tgagtaacag tgcattcgtc gggttactac ttgctcttgg aggcaccttt       480
     gtggcttcat taggaaacat ggtaagtgta cgtaattcac gcaaacaaat tggtgtgtta       540
     caaggtaatg cttggggcat gttatacagt gccattggct tagccttata tgtatttata       600
     agcgacgtgc aatttaattt cactgcacct actagctatt ggctgtcgtt attgtactta       660
     tctatttttg gcactgtaat cgcctttgct tgttactttg cactgttaaa aaatattggc       720
     cccgaaaaag ccagctatgt catcgtactg tttcctttag ttgcggtaac actaagcagc       780
     ttttatgaag gctttgaatg gcatgcaaat acctttgcag ggtttagctt agtactactt       840
     ggtaacgcca tagtgcttac cccaacaaaa cgaattaatg cctttttagc aaacagagcg       900
     gttgctagaa gaggctctgt ccccagttag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page