(data stored in ACNUC7421 zone)

EMBL: CR954246.PE530

CR954246.PE530       Location/Qualifiers
FT   CDS_pept        complement(571259..574033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0556"
FT                   /product="putative sensory box histidine kinase/response
FT                   regulator"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85644"
FT                   /db_xref="GOA:Q3ILI5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI5"
FT                   /protein_id="CAI85644.1"
FT                   /translation="MQSKFSSVIKGLLPLFLLSNVIITTLFIIAFSLYSQSEVDTKKSA
FT                   PLIDITSLANKLEAPLIDALTIYGQGKVQELLELTSVFSDNFEYTLYRFSATSQTELVY
FT                   STNKPAIAAIKLNEHLVDQGVLHKVLTLNDQPIGELILKQKKSPPTLTKQTSLLSAYFM
FT                   ACIAVITLFVLALLLNQYINNRLRKSTGLLSEELQAVTDSSNFNSTVNEQLGNGLNVIA
FT                   LNINFLLKKVQAALSENEKTRKELQKLQNNLEIEVQTRTLALEKETLNAQKASEAKTTF
FT                   LATMSHEIRTPMNGVIGTIDLLRQTNLDGSQYRLSTIIRESAFSLLSILDDILDFSKIE
FT                   AGKLNIDPIPFSVTDTIEEVVRVLSSIAKHRDLDLNLSIAPDIPINLIGDNTRVRQILY
FT                   NLCSNAIKFTSTSESHKGQVNISVEVAHNTAEHFTLRFCVTDNGKGMSQAQLREIFNPF
FT                   IQAESSITREYGGTGLGLSICKSLTELMLGTISVNSNIGIGSEFTVELPFSTSGKIKFA
FT                   HKNSLDGRHIVVVSNNVDREKVIYRYLSFMGAKITYVHNEQEIESLHDAKDIIWVVDGI
FT                   DNMDSINAFLRRLLYSLEDNNQQVVVLSKLDDAAINHKNIFYINATPLCKSNFMLSILV
FT                   AAGLHQPKHIKKTIAYDNHLTTEQALAANKLILLVEDNILNQQVITDQLHILGYGVEVA
FT                   NNGEEGINMWRKGNYSLILTDLHMPIMSGYDMVEKIRNEAEMLGSVISQPYIIAVTANS
FT                   LKGEKERCLAVGINDFITKPVELNVLENTLIRWNEKSNHKSIDIPHQKPAMPIDMDSVA
FT                   KYINGDDAKKIRFFKMYLEQSQELIKSINFGVMQSNVNEILEGCHQLKSISKTIGAHRV
FT                   AELAVVFEEQCKTDELNSDKLIDLRDQLEIEYSKAAQFLKEQIKSAEQQEQPS"
     atgcagagta agttctcttc agtgataaaa ggtttgttac ctcttttttt attaagcaat        60
     gtaattataa ccacactgtt tataattgcc ttttcacttt attctcaaag tgaagtggat       120
     actaaaaaga gcgcaccgct tattgacatc acttcactgg ctaacaagct agaagctcct       180
     ctaatcgacg ctttaactat atacggacaa ggtaaagtac aagagctgct tgagcttacc       240
     tctgtattta gtgacaactt tgaatacacg ctatatcgct ttagcgctac atcacaaacg       300
     gagctggtat atagtactaa caaacctgca attgctgcta ttaaacttaa cgagcattta       360
     gttgatcaag gtgttttaca taaagtttta acgcttaacg atcaacctat tggcgagctt       420
     attttaaaac aaaaaaaatc ccctcccact ttaactaaac aaacgtcatt attgagcgcc       480
     tattttatgg cttgtatagc ggttattaca ttatttgtat tagcattgct attaaaccaa       540
     tatattaata accgtttacg taagagtacg ggcttgctta gcgaagaatt acaggctgta       600
     actgatagca gtaattttaa cagcactgta aatgagcagt taggtaatgg cttaaatgtg       660
     attgcactaa atattaattt tttattgaaa aaagtacaag cagctttatc tgagaatgaa       720
     aaaactcgaa aagaattaca aaaactgcaa aacaatcttg aaattgaagt gcaaactcga       780
     acccttgcac ttgaaaaaga aactttaaat gcgcaaaaag caagtgaagc taaaaccacc       840
     tttttagcaa ctatgagtca tgaaattaga acccctatga atggcgttat agggactata       900
     gatttactgc gccaaacaaa tttagacggt tcacaatatc gtcttagtac cattattcgt       960
     gaatcggctt tttctttact gagtattttg gacgacattt tagatttttc taaaattgaa      1020
     gcaggcaaac taaatattga ccctatcccg ttttctgtaa ccgatacgat tgaagaagtg      1080
     gtgcgcgtac tttcttctat agctaaacac cgcgatctag atttaaactt atcaattgct      1140
     cctgatatcc ctattaacct tattggtgat aacactcgag tacgccagat actatataac      1200
     ctatgcagca atgcgattaa gtttaccagt acgagtgaat cgcataaggg gcaagttaat      1260
     atctctgtag aggtggctca caacacagca gaacacttca ctttacgttt ttgtgtaacc      1320
     gataatggta aaggcatgag ccaagcgcaa ttaagagaaa tatttaatcc gtttattcaa      1380
     gcggaaagct caataaccag agaatacggt ggaaccggcc ttggcttgtc aatttgtaaa      1440
     agtttaaccg agttaatgtt aggtactata tcggttaata gtaatattgg tataggcagt      1500
     gagttcactg tagaactgcc atttagtacc tcaggaaaaa ttaagttcgc acataaaaat      1560
     agcttagatg gcaggcatat tgttgtagta agcaataatg ttgaccgtga aaaagtaatc      1620
     tatcgttatt tatcatttat gggcgctaaa ataacctatg tgcataacga gcaagaaatt      1680
     gagtctctgc acgatgctaa agatatcatt tgggttgttg atggtattga taatatggac      1740
     agcataaatg catttttaag gcgtttactt tactctttag aggataataa tcagcaggtt      1800
     gtcgttttaa gcaagctaga tgatgcagct attaatcata aaaatatttt ttatattaac      1860
     gcaacgccat tatgtaagtc taactttatg ctatcaatac ttgtagctgc aggtttacat      1920
     cagcctaagc acattaaaaa aaccatagca tacgataacc atttaactac agagcaagct      1980
     ttagccgcta acaagcttat tttgttagtt gaagataaca ttttgaatca gcaagttata      2040
     actgatcaac tgcacatctt aggttacggt gttgaagtag ctaataacgg tgaggaaggg      2100
     attaatatgt ggcgaaaagg taactattcg ctcattttaa ccgatttaca tatgccgata      2160
     atgtcgggct acgatatggt cgaaaaaatc cgcaatgagg ccgaaatgct aggttcggtt      2220
     atttcacagc cttatataat agccgtgaca gccaactctt taaaaggtga aaaagaacgc      2280
     tgtttagctg ttggtattaa cgactttatt actaagcctg ttgagcttaa cgttttagaa      2340
     aatacactaa tacgctggaa tgaaaaaagt aatcacaaga gcatagacat accacatcaa      2400
     aagccagcaa tgccaataga tatggattca gtagctaaat acattaatgg cgatgacgcg      2460
     aagaaaatac gtttttttaa aatgtattta gagcaaagcc aagagctaat aaagtcgatt      2520
     aactttggtg ttatgcaaag caacgttaat gagattcttg aggggtgtca tcaattaaag      2580
     tctatatcta aaaccattgg ggcgcatcgc gtcgctgaac tggccgtcgt gtttgaagag      2640
     caatgtaaaa cagatgaact aaacagcgat aagttaattg atttaagaga tcaattagaa      2700
     attgaatatt ctaaagctgc tcaattttta aaagagcaaa ttaaaagtgc cgagcagcaa      2760
     gaacaaccga gttaa                                                       2775
//

If you have problems or comments...

PBIL Back to PBIL home page