(data stored in ACNUC7421 zone)

EMBL: CR954246.PE531

CR954246.PE531       Location/Qualifiers
FT   CDS_pept        575553..576971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0558"
FT                   /product="putative outer membrane transport protein"
FT                   /function="1.2.8 : Other"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0558"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85645"
FT                   /db_xref="GOA:Q3ILI8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI8"
FT                   /protein_id="CAI85645.1"
FT                   /translation="MIWQQYQPTLLALSIVLLSGCASNINSQQREQAPNNVPQQWQQKT
FT                   SAPVLHVQQQWLTQLQNPQLNKLVEQALKNNQQLLQSSYDVAIQKQQLIVSGAALWPTL
FT                   DLSARTSRSKNNRPISYNNASSVSLNLGYEVDLWGKLSDSNRQANLNYLAQQARFEQAK
FT                   QQLVADVVKGWFDIVTAKQLLDLYKHREANALQNLDIIESGYRQGLNEALDVYLARNEL
FT                   NNERSRIATQQASLLTTARVLERLLGDYPKGIISANNDLPVINTDIPLGLPSELITRKP
FT                   TLRANWYQLLASDANLAYAHKQRFPSLNLTASLSDTTDRVSDLFSPSSLAWSLLGSISA
FT                   PIFNGGRLKANEEIARLNSQKQEQQYLQTLYDAFSDVENAITLQQSLKAQYTSTLEAQE
FT                   NALAAEQLSFEQYQSGLVSYTTVLDAQGRSFDAQSSLISIKNQLIANRVNLHLALGGDF
FT                   ANTSTELQSNSNEN"
     atgatttggc aacaatacca gccaacttta ttggcactca gtattgtgct gctcagcggc        60
     tgtgcgagca atataaattc acagcagcgc gaacaagcac ctaacaatgt accgcagcaa       120
     tggcaacaaa aaacctctgc gccggtatta cacgtacagc agcaatggct tacacaatta       180
     caaaatccac agctgaataa gcttgtggag caggcactta aaaataacca gcagctttta       240
     caaagtagtt acgatgtagc gatccaaaag cagcagttaa ttgtgtcggg cgctgcgttg       300
     tggccaactc tggacttatc tgcgcgtact agccgcagta aaaataaccg cccaattagt       360
     tataataatg caagttcagt gagcttgaat ttaggttacg aagttgattt atggggcaag       420
     ctgtcagatt ctaatcgcca agctaattta aactacttag cgcaacaggc gcgctttgaa       480
     caagccaaac aacagctagt tgccgatgta gtaaagggct ggtttgatat agtaaccgca       540
     aagcaattac ttgatttata taagcaccgt gaagccaatg ctttgcaaaa tcttgatatt       600
     atagagtcag gttatcgtca aggattaaac gaagctctcg atgtttattt agctcgcaac       660
     gagctaaata atgagcgttc acgtattgct actcagcaag ctagcttatt aactacagca       720
     agagtacttg agcgtttatt gggagattat ccgaaaggaa ttatctcggc aaataatgac       780
     ctaccagtta tcaataccga cattccacta ggtttaccct cagagttaat tacccgaaag       840
     ccaacattac gtgcaaattg gtatcagctt ttagcaagtg atgcaaactt ggcttatgcc       900
     cataagcaac gttttccaag tttaaattta acggcaagtt taagtgatac tactgataga       960
     gtaagtgatt tgttttcgcc atctagccta gcatggtcat tacttggcag tatttcagcg      1020
     cctattttta atggcggccg gttaaaagcg aatgaagaaa ttgcgcgttt aaatagccaa      1080
     aaacaagagc agcagtattt acaaacactt tacgatgctt ttagcgacgt agaaaatgcg      1140
     attacgctac agcaatcact taaagcgcaa tatacaagca cgctagaagc acaagaaaat      1200
     gcccttgctg ccgagcaatt atcgtttgag caatatcaaa gtggcttggt tagctacact      1260
     acagtgcttg atgcacaagg acgctcgttc gatgctcaaa gctccttaat tagtattaaa      1320
     aatcaattga tagcaaaccg agttaattta caccttgccc ttggtggcga ttttgcaaac      1380
     acttcaaccg aactacagag taatagcaat gaaaactaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page