(data stored in ACNUC7421 zone)

EMBL: CR954246.PE532

CR954246.PE532       Location/Qualifiers
FT   CDS_pept        576961..578262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0559"
FT                   /product="putative Secretion protein"
FT                   /function="1.6 : Protein secretion"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8407802; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0559"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85646"
FT                   /db_xref="GOA:Q3ILI7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI7"
FT                   /protein_id="CAI85646.1"
FT                   /translation="MKTKTAKIIIPIAVIIATILIVMFIKGNPPEANRFGAPPKASINV
FT                   AVQMLQPQNYQVMVDSYGTVKPRTQSLLVAQASGLIINISDDFREGGFFKKGAVLIQLD
FT                   DRDYQAEVKSAQANLLTAKQGLLEEQARGQQAITDWQRLGNDKPASSLVLREPQLAAAQ
FT                   AQVLSAQATLEKAKLNLERTQIIAPFAGRVLSRNVDLGQVVSNNTQLATIYAIDSVEIR
FT                   LPIKNKDLPFINLPEQYRDGAKNQAGSVIKFSSDLVGEQTWQGQLARTEGAIDESAQQL
FT                   YVVAKINDPYKATQSNQYPIKIGQYVKAQITGKTVSDALIIANSTIYQGSYVYIVEQGV
FT                   LKRKDITLAWQNAAFAMIKTGLKAGDKLVITPLGQVSSGTQVNILGEDNKATKPQSMKQ
FT                   RPTAEQLAQQAKEQDISVAELVKKRRAAKQGDKP"
     atgaaaacta aaacagcaaa aattattatt ccaatcgcgg ttattattgc cactatttta        60
     atcgtcatgt ttattaaagg taacccgcca gaagctaatc gctttggtgc accaccaaaa       120
     gcatcaatta atgtagcagt tcaaatgttg cagccgcaaa actatcaagt gatggtagac       180
     agctacggca cagtaaaacc acgtacacaa agcttattag ttgctcaagc atcgggttta       240
     attataaata taagcgatga ctttagagaa ggtggttttt ttaaaaaagg tgcggtacta       300
     atccaactcg acgatagaga ctatcaagca gaggttaaat cggcacaggc taacttatta       360
     acagcaaagc aaggcctttt agaagaacaa gcccgcgggc agcaggctat tacagattgg       420
     cagcgtttag gtaatgataa acctgcaagt agcttggtgc tacgtgagcc acaattagct       480
     gcagcacaag cacaagtatt atcggcgcaa gcaacacttg aaaaagccaa gttaaactta       540
     gaacgtaccc aaataatagc gccttttgca ggacgagtac ttagtcgtaa tgtagattta       600
     ggccaagttg ttagcaacaa tactcagctc gctactattt acgcaataga cagcgtagag       660
     attcggttgc caataaaaaa caaagaccta ccttttatta atttacctga gcagtaccgc       720
     gacggtgcta aaaaccaggc cggatccgtg attaaattta gctctgattt agttggtgag       780
     caaacatggc aagggcagtt ggcgcgtacc gaaggtgcta ttgatgaaag tgcacagcaa       840
     ctctacgtgg ttgctaaaat taatgaccct tataaagcaa cacaaagtaa tcaataccca       900
     ataaaaatag ggcaatacgt taaagcgcag atcaccggaa aaacagtttc tgatgcactt       960
     attattgcaa atagcactat ttatcagggg tcttacgttt atattgttga gcagggagta      1020
     ttaaagcgta aagatataac gcttgcatgg caaaatgccg catttgcaat gataaaaacc      1080
     ggcttaaaag caggtgataa acttgttatt acgccactgg ggcaagttag ttcgggtaca      1140
     caagtgaata ttttaggcga agataataaa gcgactaaac cacaaagtat gaagcaacgc      1200
     ccaacagcag agcaattagc acaacaagca aaagagcaag acattagtgt tgcagagcta      1260
     gtaaaaaaac gtcgcgcagc aaagcaagga gataagccat ga                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page