(data stored in ACNUC7421 zone)

EMBL: CR954246.PE533

CR954246.PE533       Location/Qualifiers
FT   CDS_pept        578259..581342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0560"
FT                   /product="putative multidrug resistance
FT                   protein(AcrB/AcrD/AcrF family)"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0560"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85647"
FT                   /db_xref="GOA:Q3ILI6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI6"
FT                   /protein_id="CAI85647.1"
FT                   /translation="MIAWFTKNHVAANLLLVTLLLSGLFSLSTKIPIEVFPSFETDMIS
FT                   IQVSLRGATPEDVEQGVTIRIEESVQDLEGIKQIFSRSSEGSGSVTVEVESGYDPRELL
FT                   ADIKSRVDAINTFPGDAEKPIVALAERKREVIAVTVSSDYGEKETREYAEQVRDQILRL
FT                   PSVTQVELSGVRDYELAIEVSQDTLRQYDLTLAQISNAVANSSSDISAGNLKTQGGDVL
FT                   ISSKGQAYRKDEFASIVVKNQSDGTIIRLGDIATINDGFEETPVRTRFNGKQAAFIDVY
FT                   RIGPQSAITVADEVKAYINAQQPSLPQGFALSYWDDDSELVKSRIATLTTNALQGGILV
FT                   LALLTLFLRPAIAFWVFIGIPVSFMGAFIAMPIFGVTLNVMSLFGFILVLGIVVDDAIV
FT                   TGENVYTHLKTAESGEQAAILGTQEVATPVTFGVLTTVAAFLPLAFIEGARGALFAQIP
FT                   VVVIPVLLFSLIESKFVLPAHLKYIKLRHQKGKQSKFDLLQQRFADGFESAILKYYQPI
FT                   LNLALRHKLATVSLFVGVFLIILTMITSGWTKFVFFPRIPSETVRVNLTLPAGTPFEVT
FT                   NKYVIDMSQKAQQLQEKYRDPDTGESVILNILATTGGRGGVSNSGAVRFEITPAEKRDS
FT                   DIGSRELASEWRELIGVIPGAESLTFRAEIGRSSDPIDVQLSGTSLKVLQDVADHIKTR
FT                   LSTYPTVFDIADSMSDGKEELQIELTEQGLALGLNRVNVAGQVRNSFFGSQVQRIQRGR
FT                   DDVRVMVRLPIDERRSVADLQNILINTPAGGSVPLSHVAILITGQSPSTINRIDRYRTL
FT                   NVTADIEKSNTNMTILQADLSQYLDELMQQYPGVDYALEGEAKEQRESFGSLAWALVFV
FT                   FFIIYALLAIPFKSYLQPLIVMSVIPFGMIGAVVGHWIMGMELTIMSLLGMLALIGVVV
FT                   NDSLVLVDYINKKRTEGIELIEVVKLAGASRFRPVMLTSLTTFIGLMPLLFEKATQAQF
FT                   LIPMAVSLGFGIIFATFITLLLVPVNYMLMERFQGWFK"
     atgattgctt ggtttaccaa aaaccatgtt gctgccaatt tattgttagt aactttgttg        60
     ctgtctgggc tgtttagttt atcgacgaaa ataccgatcg aagtatttcc ttcgtttgaa       120
     accgatatga tcagcattca ggttagttta cgtggcgcga cgccagagga tgttgagcaa       180
     ggtgtcacta tacgtataga ggagtctgta caagatttag agggtataaa gcaaatattt       240
     agccgctcat ctgaaggttc gggctctgtc actgttgaag tggaaagcgg ctacgatcct       300
     cgagagttgc tcgctgatat aaaaagccgt gttgatgcta ttaatacctt tcctggggat       360
     gctgaaaaac ccatcgttgc tctagctgag cgaaaacgag aggttatagc ggtaactgta       420
     tctagtgatt atggcgaaaa agaaactcgc gagtatgcag agcaagtacg cgatcaaata       480
     ttacgtttac ccagtgtaac gcaggttgag ttaagtggcg tgcgcgacta cgaactggct       540
     attgaagtaa gccaagatac attgcgccaa tatgacttaa cactggcgca aatttctaat       600
     gcggttgcta actcaagctc agacatttct gcgggtaact taaaaaccca aggtggcgat       660
     gtacttatta gctcaaaagg acaagcatac cgaaaagatg aatttgccag catagtggtt       720
     aaaaaccaaa gcgacggtac tattattcgc ttaggtgata tagccacaat taatgacggc       780
     tttgaagaaa ccccagtgcg tacacgtttt aacggaaaac aagccgcttt tatcgacgta       840
     taccgaatag gcccacaaag tgcaattact gttgccgatg aagtaaaagc ttatataaat       900
     gcccagcaac cttcattgcc gcaaggtttt gcattaagtt attgggatga cgactcagag       960
     ctagttaaaa gccgtattgc cacactcacc actaacgcct tgcaaggcgg tattttagtg      1020
     ctggcactgc taaccttatt tttacgccca gctatcgcat tttgggtgtt tattggtatt      1080
     ccggtgtcgt tcatgggggc atttattgct atgcctattt ttggcgtaac gcttaatgta      1140
     atgagcttgt ttggttttat tttagtactc ggtattgtgg ttgatgatgc catagtcacc      1200
     ggagagaacg tttacaccca tttaaaaaca gccgaatcgg gcgaacaagc tgccatatta      1260
     ggtacccaag aagtagcaac gccagtgact tttggtgtat taaccacggt agcggccttt      1320
     ttgccattag cctttattga aggtgcacgc ggggcattat ttgcacaaat tccggtggtg      1380
     gttattccgg tattattgtt ttctttaatt gaatctaaat ttgttttacc tgcacattta      1440
     aaatatataa agctacgtca ccaaaaaggt aagcaatcaa agtttgatct gctacagcaa      1500
     cgttttgctg atggttttga aagtgcgatt ttaaaatatt atcaacctat tcttaattta      1560
     gctctgcgcc ataaactggc tacggtgagc ttatttgttg gcgtgttttt aattatttta      1620
     actatgatca ccagtggttg gactaagttt gtattttttc cacgtattcc cagcgaaacc      1680
     gtacgggtaa acttaaccct gcctgctggc acgccgtttg aagtaactaa taagtacgtg      1740
     attgatatgt cgcaaaaggc gcagcaatta caagaaaaat accgtgaccc tgatacgggg      1800
     gagagcgtta ttttaaatat tttagcaaca acgggcgggc gcggcggagt atctaactca      1860
     ggcgcagtac gctttgaaat taccccagct gaaaaacgtg attcagatat aggctcacgc      1920
     gagcttgcca gtgaatggcg cgaattaatt ggcgttattc ccggcgctga aagtctcacc      1980
     tttagagccg aaataggtcg tagttcagat ccaatagatg tgcagcttag cggtacatcg      2040
     ttaaaggttt tacaagacgt ggcagatcat attaaaacgc gtttatcgac ctacccaact      2100
     gtattcgata ttgccgatag tatgtctgat ggtaaagaag agttacaaat agagcttaca      2160
     gagcaaggct tagcgctggg tttaaataga gtaaatgtag cagggcaagt gcgtaactcg      2220
     ttttttggct cgcaagtaca aaggatccaa cgtgggcgag acgatgtgcg cgtaatggta      2280
     cgtttgccta ttgatgaaag acgctcggta gccgacttac aaaatatact cataaacaca      2340
     cctgccggtg gctcagtgcc tttatcgcat gtggctattt taattacagg gcaaagcccg      2400
     tctactatca atcgaatcga tcgttaccgt actttaaatg tgaccgccga tatagaaaaa      2460
     agcaacacta acatgaccat actccaagct gatttatccc agtatttgga tgagctaatg      2520
     cagcaatacc caggagttga ttatgcatta gaaggagaag caaaagagca aagagagtcg      2580
     tttggttcac ttgcttgggc gttagtattt gtatttttta ttatttatgc gctattagcg      2640
     ataccgttta aatcgtattt acagccatta atagtaatga gtgttatacc ctttggcatg      2700
     ataggcgctg tagtagggca ttggatcatg ggaatggaat taaccattat gagcttgctt      2760
     ggcatgctag cattaattgg cgtagtggtt aatgactcgc tggtattagt tgactatatt      2820
     aataaaaaac gcacagaagg gattgaatta attgaggtag ttaaacttgc cggcgcgtca      2880
     cgttttcgcc cagttatgct aactagctta accactttta taggattaat gccgttatta      2940
     tttgaaaaag cgactcaagc gcaattttta attcctatgg ctgtgagctt aggctttgga      3000
     attatattcg ccaccttcat tactttattg ctagtaccgg taaattatat gctcatggag      3060
     cgttttcagg gttggtttaa gtaa                                             3084
//

If you have problems or comments...

PBIL Back to PBIL home page