(data stored in ACNUC7421 zone)

EMBL: CR954246.PE534

CR954246.PE534       Location/Qualifiers
FT   CDS_pept        581951..582514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0561"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0561"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85648"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH3"
FT                   /protein_id="CAI85648.1"
FT                   /translation="MSDLPDYEEAQLLLEKNEIFVSPAEAHGVISGLLACGLTIDDKEY
FT                   LGLLSDVFNDGDSFSNNLKQFFGSIYKQVVASFNDEEFAFDLFLPSDDETLIDQANGLV
FT                   SWVAGFMLGFGLKQKDYGKLSADVKEVITDFSEITRLDTTFEETEEDSQALHEVIEYVR
FT                   VSALLCFAELGKDQSTASTKKTLH"
     atgagcgatt taccagatta cgaagaagcc caattattat tagaaaaaaa cgaaatattt        60
     gtatcaccgg ccgaagcgca cggtgtaatt agtggtttat tagcttgtgg gttaacgatt       120
     gacgacaaag aatacctagg gctgttaagc gatgtgttta acgatggtga ttcgtttagt       180
     aataatttaa aacagttttt tggcagcatt tataagcagg tcgttgctag ttttaatgat       240
     gaagagtttg cgtttgattt gtttttaccc agcgacgatg aaacacttat agatcaggct       300
     aatggtttgg tttcttgggt tgcaggtttt atgcttggct ttggtttaaa gcaaaaagat       360
     tacggtaaat tatcagccga tgtaaaagaa gttattaccg attttagcga aattactcgc       420
     cttgatacta cctttgaaga aactgaagaa gacagccaag cactacatga agtgattgag       480
     tatgtgcgtg tgtcggcatt actttgcttt gcagagttag gtaaagatca aagcactgct       540
     agcactaaaa aaacacttca ttaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page