(data stored in ACNUC7421 zone)

EMBL: CR954246.PE538

CR954246.PE538       Location/Qualifiers
FT   CDS_pept        complement(586328..587338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0565"
FT                   /product="putative transcriptional regulator"
FT                   /function="3.2.1.1 : Regulation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85652"
FT                   /db_xref="GOA:Q3ILI1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI1"
FT                   /protein_id="CAI85652.1"
FT                   /translation="MSTLADHYFSSCIDYLETLGLNSQAVLSAINFNEYSNKQAQQLAP
FT                   RISLNSYNALLNYAQQTLNEPLFGFKLGQQIRTADFGILGYLIESSNNLASAITALLNY
FT                   DSLVADIGRAEFEQQGELVIIRWLPNANCSPQVILRNMTAWVSVIRQLLNPQLSPSTIY
FT                   FTQAFTSNEKTVLTHWFNCPVKTNAQYNQVVFPSSYLALPFKTDNTQINLVLKQVSEQQ
FT                   LSRFKSQQLLTEKISQLFIAKNDLIDCSLIRTAGALNMTPRTLQRHLKREQISFADLLE
FT                   QERKRRVILCIGKEPLSNIAIKLGFNDQSSFNRAFKRWYNCTPLQYLKTLPKNIG"
     atgagcacac ttgccgatca ttatttttca agctgtattg attaccttga aacacttgga        60
     cttaatagcc aagctgtttt gtcggctatt aactttaatg aatacagtaa taagcaagct       120
     cagcaactcg cgccacgcat tagcttaaac agttacaacg cactgctaaa ttatgctcag       180
     caaactctaa acgagccttt gtttggcttt aagcttggtc agcaaattcg aactgccgac       240
     tttggcatat tgggttactt aattgaatcg agtaataact tagccagcgc tattaccgca       300
     ctgcttaact acgacagttt agttgcagat attggaagag cagagtttga acagcaaggt       360
     gagttggtaa ttattcgttg gctacctaat gctaactgta gcccacaggt tattttacgt       420
     aatatgaccg cttgggtaag tgttattcga caactattaa atccacagct atcgcccagt       480
     actatttatt ttacccaagc ttttaccagc aatgaaaaaa cagtactcac acactggttt       540
     aactgccccg ttaaaactaa cgcacagtat aaccaagtgg tatttccgag cagttattta       600
     gcactgccat ttaaaaccga caatacgcaa attaatttag tgcttaaaca ggtttctgag       660
     cagcaacttt cacgctttaa aagccagcag ctactaaccg aaaaaattag ccagttattt       720
     atagctaaaa atgacttaat cgactgcagt ttaatacgca cagcaggcgc actaaacatg       780
     accccgcgca ccttgcaacg ccatttaaag cgcgaacaaa tatcgtttgc cgacttactt       840
     gagcaagagc gtaaaaggcg cgtaatactg tgcattggca aagagccatt aagtaacata       900
     gcaattaaac ttggctttaa cgaccaaagt tcatttaatc gtgcttttaa acgctggtat       960
     aactgcactc cactgcaata tctaaaaaca ctacctaaaa acattggctg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page