(data stored in ACNUC7421 zone)

EMBL: CR954246.PE539

CR954246.PE539       Location/Qualifiers
FT   CDS_pept        587399..587878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0566"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85653"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI0"
FT                   /protein_id="CAI85653.1"
FT                   /translation="MVGHYENTYYIKMIQITLKQKIAATPLQVRDALLDHAQLERFFNA
FT                   KFVLLKKQNEGEIIGGKGAIRQVIMAGVRFEERIISADSNHISYQIIGNKPVAEHRGDI
FT                   YFCVSDNTPTSTEVTYNIRCKTPWWLPSLVIKFFIKKDIAQALNKLKANFKGNIS"
     atggtagggc attatgaaaa tacttattat ataaaaatga tacaaataac cttaaaacaa        60
     aagattgcag caacgcctct acaagtcaga gacgctttgc ttgatcatgc gcaattagaa       120
     cgttttttta atgctaaatt tgtcctgtta aaaaagcaaa atgaaggcga aattattggc       180
     ggtaaaggtg ctattaggca agttataatg gcaggagttc gctttgaaga gcgtataatt       240
     agcgccgata gcaatcatat tagttatcaa ataataggta ataaaccagt tgcagagcac       300
     cgtggcgata tttatttttg cgttagtgac aataccccaa caagcaccga agttacctat       360
     aacatacgct gtaaaacacc ttggtggctg ccaagcctag tgattaaatt ttttattaaa       420
     aaagatatag cacaagcgct taataaacta aaagccaact ttaagggcaa catatcatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page