(data stored in ACNUC7421 zone)

EMBL: CR954246.PE54

CR954246.PE54        Location/Qualifiers
FT   CDS_pept        61514..62959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0059"
FT                   /product="putative transcriptional regulator YdcR (GntR
FT                   family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85168"
FT                   /db_xref="GOA:Q3IDE1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE1"
FT                   /protein_id="CAI85168.1"
FT                   /translation="MILKAVSHQGHEFLYQQVIQLIRDMSAQQALLPSEKLPSLRKMAS
FT                   NLNISIPTVKQAYQALEDQGVIEAREKSGYFLKAVNMASSLPKRVKLSREPVIVNKQAL
FT                   IEQVYTAIHQAHVVPFGVANPVAAAPTDKALARNMRRVMTLAGSSAINYGPLDGYAPLK
FT                   KQLIHRYLNFGIGINMDEMVITNGAQEALAIALKCVTKPGDVVAIESPCYHGIIELIES
FT                   LGLKALEIPLCPDNGIWLNDLAQALNEHDIKACLFSTAISNPVGSFMPDKNREQLVELV
FT                   ESHNVVLIEDDVYGDLYFTPKRGTPAIAYSKKGLVLSCSSFSKTAAPSYRVGWLIAGKF
FT                   AGQARRYKRALSCSTSLINQWTLSEFVFSGEYDRNLKVLRQRLRTNKEHMRRCLQQAMP
FT                   KGTRISDPQGGCVIWLDLGCEYDSQKLFSLALEVGISITPGLIFSASNKYKSCIRLSYG
FT                   VQWSEQIEQAIVTLGKLTLLAKK"
     atgattttaa aagcggttag ccatcaaggt catgagtttt tgtaccagca agttattcaa        60
     ctgatcaggg atatgagtgc tcaacaggct ttattgccct cagaaaaact gccgtcttta       120
     cgtaaaatgg ctagcaacct taatataagt attcctacgg taaagcaggc ctatcaagcg       180
     cttgaggatc aaggggttat agaggcacgc gaaaagtcag gctacttttt aaaagccgtt       240
     aacatggcaa gcagcttacc aaaacgggtt aagctgagcc gcgagcccgt gattgtaaac       300
     aagcaggcgc tgattgagca ggtatacaca gccattcatc aggcccatgt ggtgcctttt       360
     ggagtggcta acccggttgc tgcagcacca accgataaag ccttagccag aaatatgcgc       420
     cgagtaatga cgcttgccgg tagtagcgct attaattacg ggccactgga tggttatgca       480
     ccgttaaaaa agcaacttat tcatcgctat ttaaactttg gcattggcat taatatggat       540
     gaaatggtga tcactaatgg cgcgcaagaa gcattggcaa ttgcactcaa atgcgtaact       600
     aagcccggtg acgtagtggc catagagagc ccttgctatc acggaattat agagttaata       660
     gaaagtttag gccttaaagc acttgaaata cctttatgcc cagataatgg tatttggcta       720
     aacgatttag cgcaggcgct taatgagcac gatattaaag cgtgcttatt ttctacggct       780
     attagtaatc cggttggtag ttttatgcca gataaaaatc gagaacagct ggtggaacta       840
     gttgaaagcc ataacgtagt gctcattgaa gatgacgtat atggcgacct atactttaca       900
     cccaaacgag gtacacctgc tatagcgtat tccaaaaaag gcttggtgct aagttgttcg       960
     tctttttcta aaacggctgc ccctagttat cgtgttggtt ggcttattgc ggggaaattt      1020
     gcagggcaag ctaggcgtta taaaagagca ttgagttgtt ctacctcact aattaatcaa      1080
     tggacgttat cagaatttgt ttttagcggt gaatacgatc gtaatttaaa agtacttagg      1140
     cagcgtttac gtacgaataa agagcatatg cgacgttgct tacagcaagc catgccaaaa      1200
     ggtacacgga tcagcgatcc acaaggtggc tgtgttattt ggttagactt aggctgcgag      1260
     tatgatagcc aaaagctatt ttcattagcg cttgaggtag gtataagcat tactccaggg      1320
     ttgatatttt cagcttcaaa taaatacaaa agctgtataa ggctaagcta tggtgtgcag      1380
     tggagtgagc aaatagagca agcaattgtc acactaggta aacttacctt actagcaaaa      1440
     aagtag                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page