(data stored in ACNUC7421 zone)

EMBL: CR954246.PE540

CR954246.PE540       Location/Qualifiers
FT   CDS_pept        587875..588687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0567"
FT                   /product="conserved protein of unknown function ; putative
FT                   sterol desaturase family protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85654"
FT                   /db_xref="GOA:Q3ILH9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH9"
FT                   /protein_id="CAI85654.1"
FT                   /translation="MSIEIILLALSPVFIIFVSYEFIKYRRYYDIKDSLANTALALMHQ
FT                   GCDAIALIVLMPFFYWLHQYRLFDIELSVLTIFGAFLLQDFLYYWFHKASHHIHWLWAA
FT                   HVVHHSSTKMNFSTAFRQSLMYPLAGMWLFWLPMILIGFDPLSVFTVVALNLAYQFFVH
FT                   TQTVSTLGWFEKVFNTPSHHRVHHAINPGYLDKNFAGVLIIWDKLFGTYAEEKADKPCK
FT                   YGIVGQLNSNNPLTIAFHQWAYLVKSAFKAKGVTAKLKVIFGYPTSSN"
     atgagcatag aaataatttt acttgccctt agtcctgtat ttattatttt tgtaagttat        60
     gaatttatta aatatcggcg ctattacgac ataaaagaca gcttggcgaa tacagcactg       120
     gcgcttatgc accaagggtg cgatgcaatt gctttaattg tgctaatgcc atttttttat       180
     tggttgcatc aatataggtt atttgatatt gaactgtcgg tgctgacgat atttggcgca       240
     tttttactac aagacttttt gtattattgg tttcataaag cgtcgcacca tattcattgg       300
     ttatgggctg cccatgtggt gcatcacagt tcaactaaaa tgaacttttc aaccgcattt       360
     aggcaaagct taatgtatcc gcttgcgggt atgtggttat tttggttgcc aatgatatta       420
     atcggctttg atccgctgag tgtatttacc gtagtggcgc ttaatttggc ctatcagttt       480
     tttgtgcata cccaaacggt aagtacacta ggctggtttg aaaaggtatt taacacccca       540
     tcgcatcatc gagtacatca tgctattaac cccggctact tagataaaaa ttttgccggt       600
     gtactcatta tttgggataa gttatttggc acttacgccg aggaaaaagc cgataaaccg       660
     tgtaagtacg gtattgttgg gcagttaaat agtaacaacc cactgaccat agcttttcat       720
     caatgggctt atttagtaaa aagtgcattt aaagcaaaag gggtaacggc aaagctaaaa       780
     gtgatatttg gttaccctac aagttccaat taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page