(data stored in ACNUC7421 zone)

EMBL: CR954246.PE541

CR954246.PE541       Location/Qualifiers
FT   CDS_pept        complement(588692..589087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0568"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85655"
FT                   /db_xref="GOA:Q3ILH8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH8"
FT                   /protein_id="CAI85655.1"
FT                   /translation="MSIEYSILALIGAFLTFYLAKHSRFDGIRASAALSIVTYLIFYWL
FT                   NLDPELYSVVFFGGTFIGMSAPHRFGIYTLASSAVIFSLLFEYLVPILDGYGGALGVSA
FT                   FLSVCICHLFIILGAPRSKNISFRRVK"
     atgagtattg aatattctat attagctttg ataggcgctt ttttaacatt ttatttagcc        60
     aagcatagtc gttttgatgg tattagagct tctgcggcct tatctatagt tacttactta       120
     attttttact ggcttaacct tgatcctgag ttatacagcg ttgtgttttt tggtggtact       180
     tttattggta tgagcgcccc acaccgcttt ggcatatata cgcttgccag ctccgctgtt       240
     atattttcgt tattatttga gtacttagta cccatactcg acggctacgg cggtgcttta       300
     ggtgtgagtg catttttgtc ggtatgtatt tgtcacttat tcattatatt aggtgcacca       360
     cgcagtaaaa acatttcctt tcgacgtgtt aaataa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page