(data stored in ACNUC7421 zone)

EMBL: CR954246.PE542

CR954246.PE542       Location/Qualifiers
FT   CDS_pept        complement(589087..589461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0569"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85656"
FT                   /db_xref="GOA:Q3ILH7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH7"
FT                   /protein_id="CAI85656.1"
FT                   /translation="MRAMIKFLLLKSITFFAGCMSCFVMHTTFALPLVISAALTGLVGS
FT                   FIPFPKLYQNHPYAAIYAGSFAGMCSTSLITSYWEVAIISIIGATLYTLTLNAFAGFGG
FT                   RLGSVAFASVALYSLAKGLV"
     ttgcgcgcta tgattaaatt tttattatta aagtccatca cattttttgc cggctgtatg        60
     tcgtgctttg taatgcatac aacatttgca ttaccacttg ttatatctgc agcactaacc       120
     gggctagttg gctcgtttat tccttttcct aagctttatc aaaaccaccc ttatgcggcc       180
     atatatgcag gtagctttgc cggtatgtgc tcaactagct taattactag ctactgggaa       240
     gtggcgataa tctcaattat tggcgcaacg ctatacaccc ttaccttaaa tgcatttgct       300
     ggttttggtg gcagattagg cagcgtagcc tttgcaagtg ttgctttgta ttctttagct       360
     aaaggcttag tgtaa                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page