(data stored in ACNUC7421 zone)

EMBL: CR954246.PE543

CR954246.PE543       Location/Qualifiers
FT   CDS_pept        589712..590131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0570"
FT                   /product="conserved protein of unknown function ; putative
FT                   glyoxalase domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85657"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH6"
FT                   /protein_id="CAI85657.1"
FT                   /translation="MSNCLHLAIPAGDLNIAKTFYCDVLGCKTGNSEQGRWIDIDFWGN
FT                   ELTLHQSVERLPTVRHDVDMGAVAVPHFGIHLSENEFNALKQRIESAGLEYLDKPYRRF
FT                   IGDEFEQETFFIEDPNGNVLEMKTMVNPEVLFKKS"
     atgtctaact gtttacatct ggctattccg gctggtgatt taaatatagc taaaactttt        60
     tattgcgatg tgcttggctg taaaaccgga aatagcgagc aaggacgctg gatagatatt       120
     gatttttggg gtaacgagtt aacactgcac caaagtgttg agcgcctacc tacagttcgt       180
     catgatgttg atatgggcgc agttgccgta ccacattttg gcattcattt atctgaaaac       240
     gaatttaatg cgttaaagca acgtattgaa agcgcgggct tggagtattt agataagcca       300
     tatcgtcgtt ttataggtga tgagtttgaa caagaaacat tttttataga agatcctaac       360
     ggtaacgtac tcgaaatgaa aaccatggtt aaccccgagg ttttatttaa gaaaagttag       420
//

If you have problems or comments...

PBIL Back to PBIL home page