(data stored in ACNUC7421 zone)

EMBL: CR954246.PE544

CR954246.PE544       Location/Qualifiers
FT   CDS_pept        complement(590457..591560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0571"
FT                   /product="putative alginate lyase"
FT                   /function="2.1.3.5 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="4.2.2.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8200539; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85658"
FT                   /db_xref="GOA:Q3ILH5"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014895"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH5"
FT                   /protein_id="CAI85658.1"
FT                   /translation="MNKNNITHLIKPGALIALTTSLVIGCVSQQPKSTEQQANPLVPAS
FT                   KFDLSHWKINVPVDLDNDGKIDEIDVKKIQTYSHPDFFYLDDKGYMVFTSPNKALTSAN
FT                   STNTRSEFRQMLRGANTKIKTKSPKNNFALAVHPLSDRFGSIGGKMEATLKVDHVALRA
FT                   TDPSKNAAYSVVVGQIHAGKDQALIDTKLGYGWGNEPLKIYYKKWPGHKTGSVFWNYER
FT                   NLPKTDPNRTDIAYPVWGNTWENPNEPGNAGIALGEEFSYTVNVYKNVMHLTFSTAGKN
FT                   DVSYSINLGNNVDAYGNVDEKDHPHGYAADWHYFKAGAYNQCSTKNAKGIWYPGCLGTG
FT                   DWATDKQNGDYAQVSFSKLVLSPASPQ"
     atgaataaaa ataacattac acatcttatt aagcccggcg ctttaattgc cctcactacc        60
     tctttggtta ttggttgtgt tagccaacaa ccaaaaagca ctgagcaaca agctaaccca       120
     ttagtacccg cctctaaatt tgatttatct cattggaaaa ttaatgtacc ggttgattta       180
     gataacgacg gtaaaattga tgaaatagat gttaaaaaaa ttcagactta ctcacatcct       240
     gattttttct atctggatga taaaggttac atggtattca cctcgccaaa caaagcactc       300
     accagtgcca attctaccaa tacacgcagt gaatttaggc aaatgctccg cggagcaaat       360
     accaaaataa aaaccaaaag tcctaaaaac aattttgctc ttgctgtaca cccactatcg       420
     gatcgatttg gctctattgg tggcaaaatg gaagcaacgc taaaagtaga tcatgttgca       480
     ttacgtgcta ctgatccaag taaaaatgcg gcctactctg ttgttgtggg gcaaattcac       540
     gcaggtaaag atcaggcgct tattgacact aagcttggtt atggctgggg caacgagcca       600
     ctaaaaatat attataaaaa gtggcctgga cataaaacgg gatcggtttt ttggaactac       660
     gagcgtaacc taccaaaaac agatcctaac cgtactgata tagcttatcc tgtttggggt       720
     aacacatggg aaaaccctaa cgagccaggc aatgctggta tcgcattagg tgaagagttt       780
     agttacacag taaacgtgta taaaaatgtg atgcacctaa catttagcac agcaggcaaa       840
     aacgatgtta gctactctat taacttaggt aataacgtag atgcatatgg caacgtagac       900
     gaaaaagatc accctcatgg gtatgcggct gattggcact actttaaagc aggcgcgtat       960
     aaccaatgta gtaccaaaaa tgctaaaggc atttggtatc cgggctgttt aggtacgggc      1020
     gactgggcta cagataaaca aaacggtgac tatgcacaag tgagctttag taaacttgta      1080
     ttaagccccg ctagtccaca ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page