(data stored in ACNUC7421 zone)

EMBL: CR954246.PE545

CR954246.PE545       Location/Qualifiers
FT   CDS_pept        591888..592673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0572"
FT                   /product="conserved protein of unknown function; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85659"
FT                   /db_xref="GOA:Q3ILH4"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH4"
FT                   /protein_id="CAI85659.1"
FT                   /translation="MVAPLLLLFISYAQKKFGSFISGIIPGLPITSGPISYFIAIEQGK
FT                   LFAANSAVGALYGMSGIGLFCFVYMAVSYKCGLAKSLLIALSVWCLFSILTLFLPVNIF
FT                   VACLFSISTLLALTFATTKLKVAIDAKPLNSKWELPIKIVLVTSFIMLVTFISEHIGSA
FT                   WSGLLSTFPVILAVMGSIAYISDKKDSAFKILNGGIIGSLGGCIFFAAIALLLKYDILI
FT                   WQVYTVATISSVLFTLIFSHFINRKYVNPVAFNTAKTQL"
     atggttgccc cgctattact gctctttatt tcttacgcgc aaaaaaagtt tggtagtttt        60
     ataagcggta ttattcctgg cctgccaatc acctctgggc ctatttcata ttttattgct       120
     atagagcaag gaaaactgtt tgcagctaac tcagcggtgg gcgctttata tggcatgagt       180
     ggtattggtt tattttgctt tgtgtatatg gcggtttcgt ataagtgtgg cttagcaaag       240
     tcgttgttaa tagcgctgag tgtgtggtgt ttatttagca tactgacatt atttttaccg       300
     gttaatattt ttgtagcgtg cttgttctct attagtactt tattggcttt aacttttgct       360
     actacaaaat taaaagtagc gatagatgca aagcctttaa attcaaaatg ggagctgcca       420
     ataaaaatag tgttagtaac tagttttatt atgttggtta cctttatttc tgagcatatt       480
     ggctcggcat ggagtgggtt gctttctact tttccggtta ttttagcggt aatgggcagc       540
     atagcgtata tcagtgataa aaaagactca gcatttaaaa tactaaacgg cggtattatt       600
     ggctcattag gtgggtgtat attttttgcc gccattgcat tgctattaaa atacgatatt       660
     ttaatttggc aagtttatac agtggcaact attagctcgg tgttgtttac gcttattttt       720
     agccatttta taaaccgtaa atacgttaat ccggttgctt ttaataccgc taaaacgcag       780
     ctttag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page