(data stored in ACNUC7421 zone)

EMBL: CR954246.PE546

CR954246.PE546       Location/Qualifiers
FT   CDS_pept        complement(592682..593683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0573"
FT                   /product="putative AraC-family transcriptional regulatory
FT                   protein"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85660"
FT                   /db_xref="GOA:Q3ILG3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG3"
FT                   /protein_id="CAI85660.1"
FT                   /translation="MSAYYWQNKHKKSPITRKSLPKTIKIVILRKSQPCKDAFMSTIAN
FT                   MLQQYAEQNQLLSFEGTMETIITGVYFHRASKSSPRQPLIYNSGIIVVGQGHKVIHFTD
FT                   HKIQYGAGDYLVLGVPVPLECEAFTDGDLPVLGIAVDINPALLHKLVNQMTEHKQFALP
FT                   PTCGQMSGVQSAKLDNAMELVTKRLLTVLNNPLEAQVFGEDIVKELVYRVLCGPQGHTL
FT                   FGLAMHDGHYARIARTLSIMHSNYANPITVEGLAEDVNMSISSFHRAFKQVTFESPLQY
FT                   LKKLRLAKAKALITASGSKANEAALKVGYTSPSQFSREFKRHFNKTPKEMLL"
     atgagtgcat attactggca aaacaaacat aaaaaaagcc caataacgcg caaaagcttg        60
     cctaaaacta tcaagattgt tattttacgt aaaagtcagc catgtaaaga tgcttttatg       120
     tccaccattg ccaatatgtt gcagcagtac gcagaacaaa atcagttact cagttttgaa       180
     ggcacgatgg aaaccattat tactggggtt tattttcatc gcgccagtaa aagctcgccg       240
     cgacagccgc ttatttataa ctctgggatt attgtggtcg ggcaagggca taaagtaatt       300
     cattttacag atcataaaat acaatatggt gcgggggatt atttagtatt gggcgttcct       360
     gtaccgctag agtgcgaagc ctttactgat ggcgacttac cagtgcttgg gattgctgtt       420
     gatattaacc ctgcgttatt gcacaaactc gttaaccaaa tgactgagca taaacaattt       480
     gctctgccac caacatgcgg gcaaatgagt ggcgtgcaat cggctaaact cgataacgcg       540
     atggagctgg taactaagcg tttattaacc gtgttaaata acccacttga agcacaagta       600
     tttggcgaag atatagtaaa agaattagta taccgtgtac tttgcggccc ccaaggacat       660
     accttgtttg gccttgctat gcacgacggc cactatgcac gtatagcgcg cacactgtct       720
     attatgcata gtaattatgc caaccccatc acagtagaag ggttagcaga ggacgtaaat       780
     atgagcattt cgtcgtttca tcgcgccttt aaacaagtga cttttgagtc gccgttacaa       840
     tatttaaaaa agctgcgttt agccaaagca aaagcactta taaccgccag tggcagcaaa       900
     gccaacgaag ccgcattaaa agtaggctat accagcccat cgcaatttag ccgagaattt       960
     aaacgccact ttaataaaac accaaaagaa atgttactct aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page