(data stored in ACNUC7421 zone)

EMBL: CR954246.PE547

CR954246.PE547       Location/Qualifiers
FT   CDS_pept        593751..594896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0574"
FT                   /product="putative alcohol dehydrogenase with
FT                   dehydroquinate synthase-like domain"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85661"
FT                   /db_xref="GOA:Q3ILH2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH2"
FT                   /protein_id="CAI85661.1"
FT                   /translation="MKFSYVNPTLIQFGQQQIASLTDLIAKDQKVLVVYGGGSIKKNGV
FT                   YDQVAAALEGFDWVEFSGVGANPTIEVLDQAVKICKEQDIDFVLGVGGGSVIDGVKYIA
FT                   ASAVYDGEGWDIPTGKHKVTSALPIGAVLTLPATGSESNQGSVVSKAATKQKLPFMSPA
FT                   VQPKFAIMDPDVMKTLPQRQLVNGLVDAWVHTCEQYLTFPEGALVQDGYAEALLKALKV
FT                   LGDNFENQDDAWRANLMWSANQALNGLIGSGVSQDWATHMIGHELTAAYGVDHARSLAI
FT                   VQPSLLRNQFAVKKAKLEQMGKNVFGLAQSDDLAELTIQAIEAFYHSLDVATQLTEHGE
FT                   DKAAAIDNIIGKLEAHGMLALGENQAITLKESREILEQAVA"
     atgaaattta gctacgtaaa tccaacacta attcaatttg gccaacaaca aatagcctca        60
     ctaactgatt tgatcgcaaa agatcaaaaa gtactagttg tgtacggcgg cggatcaatt       120
     aaaaagaacg gcgtatacga ccaagttgca gcagcacttg aaggttttga ttgggtagag       180
     ttttcgggcg ttggcgctaa cccaacaatt gaagtactag atcaagcagt aaaaatctgt       240
     aaagaacaag acatcgactt tgtactaggt gttggcggcg gctcagtaat tgacggcgtt       300
     aaatacattg cagcttcagc agtatacgat ggcgaaggtt gggatattcc tactggtaag       360
     cataaagtaa ctagcgcatt accaattggt gcagtactta cattaccagc tactggctca       420
     gagtctaacc aaggctcagt agtaagcaaa gctgctacaa aacaaaaact cccgtttatg       480
     tcaccagcag tacaacctaa atttgcgatt atggaccctg atgtaatgaa aacattacca       540
     cagcgtcaac ttgtaaatgg tttagtagac gcatgggtgc atacctgtga gcagtactta       600
     acgttccctg aaggtgcatt agtacaagat ggttacgctg aagcattgct taaagcactt       660
     aaagtacttg gcgataactt tgaaaaccaa gatgacgcat ggcgtgcaaa tcttatgtgg       720
     tcagcgaatc aagcattaaa cggtttgatt ggttctggtg tatcgcaaga ttgggcaacc       780
     catatgattg gtcacgaact tacagctgca tacggtgttg accatgcacg ttcgcttgca       840
     atagttcagc cttctttact acgcaatcaa tttgcagtta aaaaagcaaa acttgagcaa       900
     atgggtaaaa acgtatttgg ccttgcacaa tcagacgatt tagcagagct aacaattcaa       960
     gcaattgaag cgttttacca tagccttgat gtagctacgc agcttactga acatggtgaa      1020
     gataaagcag ccgcgattga caatattatt ggcaaacttg aagcgcatgg catgcttgcc      1080
     cttggtgaaa accaagcaat cacgctaaaa gaaagtcgtg aaattttaga acaagcagtc      1140
     gcttaa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page