(data stored in ACNUC7421 zone)

EMBL: CR954246.PE548

CR954246.PE548       Location/Qualifiers
FT   CDS_pept        complement(595007..595393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0575"
FT                   /product="putative Zn(II)-responsive transcriptional
FT                   regulator, regulates Zn export (MerR family)"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85662"
FT                   /db_xref="GOA:Q3ILH1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILH1"
FT                   /protein_id="CAI85662.1"
FT                   /translation="MQIKQLAHLVNINAKTIRYYEQINLIPAPKRESNGYRTYTQADTE
FT                   RLIFIRRCRDLQIPIDDIKTLLVAQSYGDKSCVEVDDIIENQLIKVRAAQKELKKLEVS
FT                   LASLLTNCTANTINDCQIIKELNS"
     atgcaaatca agcaacttgc tcacttagtt aatattaatg caaaaacaat tcgctattac        60
     gaacaaataa accttattcc tgctccaaaa agagagagca acggctatag aacctacacc       120
     caagcagata cagagcgtct tatttttatt cgacgctgtc gcgatttaca aattccaata       180
     gacgatatta aaactctact tgttgcgcaa tcatacggcg ataaatcgtg tgttgaggtt       240
     gacgatatta tcgaaaacca attaattaaa gtacgagcgg cacaaaaaga acttaaaaag       300
     ctcgaggtat cgcttgccag cttattaact aactgcaccg caaatactat aaacgactgc       360
     caaataataa aagaattaaa tagttaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page